KEGG   Ferroplasma acidiphilum: FAD_1044Help
Entry
FAD_1044          CDS       T04783                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fai  Ferroplasma acidiphilum
Pathway
fai00620  Pyruvate metabolism
fai00680  Methane metabolism
fai00720  Carbon fixation pathways in prokaryotes
fai01100  Metabolic pathways
fai01120  Microbial metabolism in diverse environments
fai01200  Carbon metabolism
Module
fai_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FAD_1044
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    FAD_1044
   00680 Methane metabolism
    FAD_1044
Enzymes [BR:fai01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FAD_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ARD84925
UniProt: A0A1V0N491
LinkDB All DBs
Position
complement(1045307..1046818)
Genome map
AA seq 503 aa AA seqDB search
MSTQHPDNALMPEWSSNKNIITNEDEIEEAYIAYKKLGIQEVMWDAEGKDVDTHVIRKLF
AKDRIFFENSKIGQDIFLTYRVPNPLIEGAERKILNETLNSIPLNYDVSNRIFNNGIAPI
FEVILPFTTDYRSMLNVVKFYEKCVVGAQSINLYDNVYSKDVTGEVLPGKINLIPLIEDK
DSIFNIEHIVKEYHRVISPEYMRIFIARSDPAMNYGMIPATLLAKYAASKMDQISEDTGM
SVYPIIGAGSSPFRGNLGPANIKRALSEYDQYYTFSIQSAFRYDYNDQEVKDSIKLINKH
TPQKAEFIDIETEKIIKGIVGTYSERFQKIIEDIAQPINDITFYLPKRRERKLHIGLFGY
SRSTGKASLPRAISFVGALYSIGIPPEILGIASLSSLPESSQVLLKKLYRYMEQDIKASA
QYFNYESLDYLKEIWRVSDKTLDMIREDIKYVEDNIGIPTETSYNVQKHNLYTKLLLMAF
KNRKFEEVKSYIYELSLLRKFIG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacccaacatcctgacaatgcattgatgccggaatggagttcaaataaaaatata
attacaaatgaagacgaaatcgaagaagcttacatagcgtataaaaaattaggaatacag
gaggtaatgtgggatgcagaagggaaagatgtagatacacatgtaataaggaaattattt
gcaaaggaccgcattttctttgaaaatagcaaaattgggcaggatattttcctgacatac
cgggttccaaatccattaattgaaggggctgaaagaaaaattctgaatgagactctaaat
agcatcccacttaattatgatgtttcaaacaggatattcaataatggaatagctccaata
tttgaggtaatacttcccttcaccacagattacaggagcatgctgaatgtggtcaaattt
tatgaaaaatgtgtggtgggagcacaatccatcaatctttatgacaatgtttattcaaag
gatgttacaggggaagttcttccaggcaagattaacctgattccattgatagaagataaa
gattcaatatttaatattgagcatattgttaaggaatatcacagggttatttctccagaa
tatatgagaatctttattgcaaggtcagatcctgcaatgaattacgggatgattcctgca
acgttgcttgcaaaatatgcagcgtctaaaatggaccaaataagtgaggatactggaatg
tcagtatatccaataatcggagccggctcttcaccattcaggggaaatcttggccctgca
aatataaaaagggcactttctgaatacgatcaatactatactttctctatacaatcagct
tttagatacgattacaatgatcaggaagtcaaagattcaattaaattaatcaataaacat
acgccacagaaagctgaatttattgatatagaaactgaaaaaataataaagggaattgtg
ggcacatattctgaaagatttcagaaaattatagaggatattgcacagccaattaatgac
ataacattttatcttccgaagagaagggagcggaaattgcatatagggctatttggatac
tcccgtagtacaggaaaagctagtttgccacgtgcaatttcctttgttggtgctctttat
tcaattggaattcccccggagatacttggaatagcttccttatcgtccctaccggaatcc
agtcaggtgctgttaaagaaattataccgttatatggaacaggatataaaagccagtgca
caatacttcaactacgaatcacttgactatttaaaagaaatctggagggttagcgataaa
actctggatatgataagggaagatattaaatatgttgaagataacataggcattccaacc
gaaacatcatataatgtgcagaaacataatttatacactaaattactgctcatggcattt
aaaaataggaaatttgaagaagttaaatcatatatttacgagctcagcctgttaagaaaa
ttcataggttaa

DBGET integrated database retrieval system