KEGG   Frankia alni: FRAAL0380Help
Entry
FRAAL0380         CDS       T00384                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase, PLP-dependent, isozyme beta
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fal  Frankia alni
Pathway
fal00250  Alanine, aspartate and glutamate metabolism
fal00410  beta-Alanine metabolism
fal00430  Taurine and hypotaurine metabolism
fal00650  Butanoate metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal02024  Quorum sensing
Module
fal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FRAAL0380 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FRAAL0380 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FRAAL0380 (gadB)
   00430 Taurine and hypotaurine metabolism
    FRAAL0380 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FRAAL0380 (gadB)
Enzymes [BR:fal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FRAAL0380 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC DUF5386
Motif
Other DBs
NCBI-ProteinID: CAJ59056
RhizoBase: FRAAL0380
UniProt: Q0RTP2
LinkDB All DBs
Position
448515..449921
Genome map
AA seq 468 aa AA seqDB search
MALHGKASGSQAEQTVDVRPQLVRPGEDVVVPRFRIPRESISPETAYQIVHDELMLDGNA
RLNLATFVTTWMDPQADRLMAECASKNMIDKDEYPQTAELEKRCVNILADLWHAPDSEHA
VGCSTTGSSEACMLAGLALLRRWRARRRAAGAPADRPNLVMGVNVQVCWDKFARYWDVEP
RLVPMAPGRTHLTADEAAARCDENTIGVVAILGSTFDGSYEPVAEIAAALDRLAAAGGPD
VPVHVDGASGGFVAPFCDPELVWDFQLDRVVSINASGHKYGLVYPGVGWVLWRDRAHLPD
ELVFEVDYLGGKMPTFSLNFSRPGAQVVTQYYTLLQLGFAGYRRVAQACRDNARWLADEV
ARMGPFELVSDGSGIPAFAFRLRDEITDYTVFDISELLRTRGWLVPAYRFPPDLTDLAVL
RIVVRHEFSRDLAGLLVADLRRVVDRLSGAGRPLPPPPPDGEAASFHH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcacgggaaggcgagtgggtcgcaggcggagcagacggtcgacgtgcggccg
cagctggtccggccgggggaggacgtggtcgtcccccggttccggatcccgcgggagtcg
atctcgcccgagaccgcctaccagatcgttcatgacgagctgatgctcgacggcaacgcg
cggctgaacctggcgacgttcgtgaccacctggatggacccccaggccgatcggctgatg
gccgagtgcgcatccaagaacatgatcgacaaggatgagtacccgcagacggcggagctg
gagaagcgctgcgtcaacatcctcgcggacctgtggcacgcccccgactcggagcatgcg
gtcggctgctcgaccaccggctcctccgaggcgtgcatgctcgccggcctggcgctgctg
cgccgctggcgggcccggcggcgggcggcgggcgccccggccgaccggccgaacctcgtc
atgggcgtcaacgtccaggtgtgctgggacaagttcgcccgctactgggacgtggagcca
cggctggttccgatggcgccgggccgcacgcacctgaccgcagacgaggccgccgcacgc
tgtgacgagaacacgatcggcgtcgtggcgatcctcggctcgacgttcgacggcagttac
gagccggtcgccgagatcgccgccgcactcgaccgcctggccgccgcgggtggcccggac
gtgccggtgcacgtcgacggcgcgtccggcgggttcgtcgccccgttctgcgaccccgaa
ctggtctgggacttccagctcgaccgggtcgtgtcgatcaatgcctcggggcacaagtac
gggctggtctacccgggggtcggctgggtgctgtggcgcgaccgcgcccacctgccggac
gagctcgtgttcgaggtggactacctcggcgggaagatgccgacgttctcgctgaacttc
tcccggccgggggctcaggtcgtcacgcagtactacacgctgctccaactgggcttcgcc
ggctaccgccgggtggctcaggcgtgccgggacaacgcccggtggctcgccgacgaggtg
gcccggatgggtcccttcgagctcgtctcggacggcagcgggattcccgcgttcgcgttc
cggctgcgcgacgagatcaccgactacaccgtcttcgacatctccgagctgctgcgtacc
cgcggctggctggtgcccgcctaccggttcccgccggacctgaccgacctcgccgtgctg
cggatcgtggtacgccacgagttcagccgcgatctcgccgggctgctcgtcgccgacctg
cgccgggtcgtggacaggctgagcggcgccgggcggcccctcccgccgcccccgccggac
ggcgaggcggcctccttccaccactga

DBGET integrated database retrieval system