KEGG   Frankia alni: FRAAL0594Help
Entry
FRAAL0594         CDS       T00384                                 

Gene name
argE
Definition
(GenBank) Phosphoenolpyruvate carboxylase (PEPCase) (PEPC)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fal  Frankia alni
Pathway
fal00620  Pyruvate metabolism
fal00680  Methane metabolism
fal01100  Metabolic pathways
fal01120  Microbial metabolism in diverse environments
fal01200  Carbon metabolism
Module
fal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FRAAL0594 (argE)
  09102 Energy metabolism
   00680 Methane metabolism
    FRAAL0594 (argE)
Enzymes [BR:fal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FRAAL0594 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CAJ59268
RhizoBase: FRAAL0594
UniProt: Q0RT35
LinkDB All DBs
Position
complement(649602..652538)
Genome map
AA seq 978 aa AA seqDB search
MSGISANPGRPIRAKAEPGRPRRTADPGEPRRTTGGGVTTERSASTTLDELAPDPGAFAG
GVSSDARHAAVRAGVRRLGDLLGQALTRHEGAATLALVEQVRALARRPDNGAELGRLLAT
VDDRTAIVLARAFTAYFQLANITEQLHRSRELSDRAKGPLTETFDRMAAALDAGTLDRSL
AESIARRLELRPVFTAHPTEASRRSVLDTLRRIADLLDADSPDGAVPAADRDRTQRRLAE
MVDVLWQTDELRVERPKPADEARSAAYYLELIATEVLPDLLEELDLALARVGLTLPAGAH
PVRFGSWAGGDRDGNPNVTPAVTLEVLTLQHEFGIRLLTASVERLIQELTASTRVVGVGD
ELLSSLAADREALPEVHDRYIRLNAEEPYRLKCSYILARLAGTRERLAAGAPHVPGRDYG
GVAEILDDLEVMRASLNAGDGSLVADGPLLRVIRTARAMGLSLATLDIREHADKHHAALA
AVYDQVGELDVPYAQLDRPARRTLLSAELARRRPLLGAVPPPLPPAVLGTLELMRTVREA
LDRFGGDVIESYIVSMTRDVDDILAVVVLAREAGLVGLGFADRPAWARIGFVPLFETVAE
LRAAGSLLDGMLSDPSYRSLVRARADVQEVMLGYSDSSKDAGITASQWEIHKAQRELRDV
ARRHGVVLRLFHGRGGSVGRGGGPSGEAIMAQPFGTLDGSIKVTEQGEVISDKYTLPQLA
RHNLEITLAAVVEASILHRSSRLSPTVLAGWNETMQAVADSARVTYQAFVGDPALVPFFL
AATPVEELGNLNIGSRPSRRPGGTGGLADLRAIPWVFGWTQSRIILPGWFGVGTGLAAAR
AAGAGDTLAEMYRSWHFFRTFLGNVQMTLAKSDLTIAQRYVSTLVGDDGGTIFETIRAEH
ARTVAEVLTVTGQAELLENAPTLRHTLEVRDAYLAPLHALQVSLLARARAAGEGADPLLR
RALLLTINGIAAGLRNTG
NT seq 2937 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggcatctcggcgaacccaggcagacccatacgggccaaggcagaaccaggcaga
cccaggcgtacggcagacccaggcgaacccaggcgaaccaccggaggcggcgtgacgacc
gagcggagcgcgagtacgaccctggacgagctggccccggatcccggcgccttcgccggc
ggagtctcctccgacgcccgccatgcggccgtgcgggcgggggtccgccggctcggggat
ctgctcggccaggccctgacccggcacgagggcgcggcgacgctcgcgctcgtcgaacag
gtccgcgcgctggcccgccggcccgacaacggcgccgaactcggccggctgctcgccacc
gtggacgaccggacggccatcgtgctcgcccgtgccttcaccgcctacttccagctcgcc
aacatcaccgagcagctgcaccggtcccgggaactgtccgatcgggcgaagggcccgctg
acggagaccttcgaccggatggccgccgcgctcgacgccggcaccctcgaccggtcgctg
gccgagtcgatcgcccggcgcctggagctgcgcccggtcttcaccgcccacccgaccgag
gccagccgccgctcggtgctcgacacgctgcgccgcatcgccgacctgctcgacgccgac
agcccggacggcgcggtcccggccgccgaccgggaccgcacgcagcggcgcctcgccgag
atggtcgacgtcctgtggcagaccgacgagctgcgggtggagcggccgaagcccgccgac
gaggcccgctcggcggcctactacctggaactgatcgccaccgaggtgctgcccgacctg
ctggaggagctcgacctggcgctcgcccgggtggggctcacgctgccggccggggcgcac
ccggtgcggttcggctcctgggcgggcggcgaccgcgacggcaacccgaacgtgactccg
gcggtcaccctggaggtgctcaccctccagcacgagttcggcatccggttgctgaccgcc
tcggtcgaacggctcatccaggagctgacggcgtccacccgggtggtgggggtcggcgac
gagctgctgtcctcgctggccgcggaccgcgaggcgctgcccgaggtccacgaccgctac
atccggctcaacgcggaggagccctaccggctcaagtgcagctacatcctggcgaggctc
gccggcacccgggaacggctggccgccggtgcgccgcacgtgcccgggcgtgactacggc
ggcgtcgccgaaattctcgacgacctggaggtgatgcgcgcctcgctcaacgccggcgac
ggatccctcgtcgcggacggcccgctgctgcgcgtcatccgcaccgcgcgcgcgatgggg
ctgtcgctggccaccctcgacatccgcgagcatgccgacaagcaccatgcggccctggcg
gcggtgtacgaccaggtcggggagctcgacgtgccctacgcccagctcgaccggcccgcg
cggcgcacgctgctgtccgcggagctcgcccggcgccggccgctgctcggcgccgtgccg
ccgccgctgcccccggcggtgctgggcacgttggagctgatgcgcaccgtgcgggaggcg
ctggaccgcttcggcggcgacgtcatcgagagctacatcgtctcgatgacccgcgacgtc
gacgacatcctggccgtggtcgtgctcgctcgggaggccggcctggtcggtctcggcttc
gccgaccgccccgcctgggcccgcatcgggttcgtcccgctgttcgagacggtggccgag
ctgcgggcggccggctcgctgctcgacggcatgctgtccgacccctcctaccgctcgctg
gtgcgcgcccgcgccgacgtgcaggaggtcatgctcggctactccgactcgtcgaaggac
gcggggatcaccgcgtcccagtgggagatccacaaggcacagcgggaactgcgcgacgtc
gcccgccgccacggcgtcgtgctgcggctgttccacggccgcggcggctccgtcggccgc
gggggcggcccgagcggcgaggcgatcatggcacagccgttcggcacgctggacggctcg
atcaaggtcaccgagcagggcgaggtgatctcggacaagtacacgctgccccagctcgcc
cggcacaacctggagatcaccctcgcggccgtggtcgaggcgtcgatcctgcaccgatcc
tcgcggttgagcccgaccgtgctcgccgggtggaacgagaccatgcaggcggtcgcggac
tcggcccgggtcacctaccaggcgttcgtgggcgatccggcgctcgtgccgttcttcctc
gccgccaccccggtggaggagctcggcaacctcaacatcggctcccggccgtcgcgacgg
cccggcggaaccggggggctcgccgacctgcgcgcgatcccctgggtgttcggctggacg
cagtcacggatcatcctgcccggctggttcggtgtgggcaccggcctggccgcggcccgg
gccgcgggggccggcgacacccttgccgagatgtaccggtcgtggcacttcttccggacc
ttcctcggcaacgtgcagatgaccctcgccaagtccgacctcacgatcgcccagcggtac
gtctcgaccctcgtcggcgacgacggcggcacgatcttcgagaccatccgcgccgagcac
gcccgcacggtcgccgaggtcctcacggtcaccggccaggccgagctgctggagaacgcc
ccgacgctgcgccacaccctcgaggtccgcgacgcctacctcgccccgctgcacgccctg
caggtctccctgctcgcccgcgcccgcgccgccggggagggcgccgatcccctgctgcgc
cgggcgctgctgctgacgatcaacggcatcgccgccggccttcgcaacaccggctga

DBGET integrated database retrieval system