KEGG   Frankia alni: FRAAL4382Help
Entry
FRAAL4382         CDS       T00384                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fal  Frankia alni
Pathway
fal03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fal00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    FRAAL4382
Enzymes [BR:fal01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FRAAL4382
DNA repair and recombination proteins [BR:fal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FRAAL4382
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: CAJ63024
RhizoBase: FRAAL4382
UniProt: Q0RHK2
LinkDB All DBs
Position
4763378..4765123
Genome map
AA seq 581 aa AA seqDB search
MGSDDAGGDHARGSRLAEYRSRRHSGRTPEPDVSPLADAGDDGGRRTPRSQERPTSPAPP
PPDHTGDDQNGRGDRFVIHEHHARRLHWDVRLERDGVLVSWAVPRGLPTDSRRNHLAVRT
EDHPLAYADFAGTIPKGEYGAGEVSVWDRGRYRLESWSAEKVKVTLLGERVQGRYAFFAT
GRAHGGGTGSDQRSDRGDRNWMVHRMDPRGDTDPGGTDPDGTGQPRRAGRPARTDPARSP
DLPGGTESRDSMDPPGDPERTPMPGRMAPMLAVPAAAPPEGDDWAYEVKWDGVRALAFVD
GGRPRLRSRSGHDVTDVFPELHTLGPAFGATQVILDGEIVAFGPAGTPDFELLSHRVHIA
TPAIARRAAATIPVRYLVFDLLFLDGHSLLAWPYSGRRALLADLADRGRLRISEELVGTG
DEVVAASAAAGLEGVVAKRRSSPYQPGRRSVDWVKVRHVRRQSVLVGGWEPGTGRRADRI
GALLVGVATPAGPRYAGQVGTGFSEATLDRLAALLAPLRRSDPPLRDVPAEVARGAVWVD
PELIAEVEFTSWTTDGRLRHPSFQGLRIDISPADTARMEET
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgacgacgccggtggcgaccacgcgcgagggtctcggctggccgagtaccgg
tctcgccggcacagcgggcgcacccccgaaccggacgtgtcacccctcgccgatgcgggc
gacgatggcggccggcgtaccccccgttcgcaggagcgcccgacctcccccgcacccccg
ccgcccgatcacacgggagacgaccagaacggccgcggcgaccggttcgtgatccacgag
caccacgcccgccggctgcactgggatgtccgcctggaacgggacggggtcctggtcagt
tgggcggtgccccgcggattgccgacggattcccgcaggaaccatctggccgtccgcacc
gaggatcatcccctcgcctacgccgacttcgccgggaccatcccgaagggggagtacggc
gccggtgaggtgagtgtctgggaccgtggccgctaccggctggagtcctggtcggcggag
aaggtcaaggtgacgctgctcggcgagcgggtccagggacgttacgcgttcttcgccacc
ggacgcgcccacggcggggggaccggatcggaccagaggtcggaccggggggaccgaaac
tggatggttcaccggatggacccgcggggcgacacggacccaggcggcacggatccagac
ggcacgggccagccacgccgcgcgggccggccggcccgcacagacccggcgcgcagcccg
gacctgccggggggtacggaatcgcgggacagcatggacccgccgggcgaccccgaacgc
acgccgatgccgggccggatggcaccgatgctcgccgttcccgccgccgcaccgccggag
ggggacgactgggcctacgaggtcaagtgggacggggtacgggcactcgccttcgtcgac
ggcggccggcccaggctgcgcagccgctcggggcacgacgtcaccgacgtcttccccgag
ctgcacacgctcggcccggcgttcggcgccacccaggtgatcctcgacggggagatcgtc
gccttcggcccggcgggtacgcccgacttcgagttgctcagccaccgggtacacatcgcg
acgccggccatcgcgcgtcgtgccgcggcgacgattcccgtccggtacctggtgttcgac
ctgctgttcctcgacgggcactcgctcctcgcatggccctactccgggcggcgggcgctg
ctggccgacctcgccgaccgcgggcggctgcgcatctccgaggaactggtcggtacgggc
gacgaggtcgtggcggcgagcgccgccgccggcctggagggggtcgtggccaaacggcgc
agttccccctaccagcccggtcggcggtcggtggactgggtgaaggtgcggcatgtccga
cggcagagtgtgctcgtcggcgggtgggagcccggcaccggtcggcgcgccgaccggata
ggggccctgctcgtcggtgtcgccacgccggccggcccccgctacgccgggcaggtcggc
accggcttcagcgaagcgacgctcgaccggctggccgcgttgctggcgccgttgcgccgc
tcggaccctccgcttcgggatgtccccgccgaggtcgctcgcggcgccgtctgggtggat
cccgagttgatcgccgaggtcgagttcacctcgtggacgacggacggccggctacgtcac
ccgtccttccaagggctgcgcatcgacatctcccccgccgacaccgcccgtatggaggag
acctga

DBGET integrated database retrieval system