KEGG   Frankia alni: FRAAL5273Help
Entry
FRAAL5273         CDS       T00384                                 

Definition
(GenBank) putative aldehyde dehydrogenase
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CAJ63906
RhizoBase: FRAAL5273
UniProt: Q0RF45
LinkDB All DBs
Position
5714843..5716351
Genome map
AA seq 502 aa AA seqDB search
MPADEDPRIRRGIRDDRGVGVREHRELFIDGRWVGATTEETLAVVSPATEETIGVVAAAG
IGDVDRAVAAARRALDDGPWARATPPQRVAALVRLADALRARADELAEVLTAEVGSPRSW
SQPYQVGTALAAFDAFAALAGDYPWADERPAAHGSVLVRRLPVGVVGAVVPWNAPLFITA
LKLGPALVAGCTVVLKPAPAAPVWSYLFAEAVVEAGLPPGVVNIVPAGTAASEYLVGHPG
VDKVTFTGSTAVGRRIGEVCGRDLRRCTLELGGKSAAILLDDVSLTRRTVTTLTFGAMAN
SGQVCMAQTRILAPRSRYSEVVDALAERVAALRVGDPTEPKTQIGPVISASARARIEAHL
ARARTDGARVAAGGGRPAGLDRGWFVEPTLLAGVGNDAPVAREEIFGPVAVVIPYDGVEE
AVTLANDSDYGLAGSVWSEDPERAGRVAARLRTGSVAVNSPAPLDPGSPFGGMGASGIGR
EGGPEGVDAFVELQSIIRPADG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcggacgaggatcctagaattcggcgcggaatccgggacgaccgaggagtcggt
gtgcgcgaacatcgggagctgttcatcgacggccggtgggtcggcgccacgacggaggag
acgctggccgtggtctcgccggccaccgaggagaccatcggtgtggtcgcggcggccggc
atcggcgacgtcgaccgggccgtggccgccgcgcggcgcgcgctggacgacggcccctgg
gctcgcgcgaccccaccgcaacgggtggcggcgctggtgcggctggccgacgcgctgcgc
gcccgggccgacgagctcgccgaggtgctcacggcggaggtcggctcgccccggtcctgg
tcgcagccctaccaggtgggcaccgccctggcggcgttcgacgccttcgccgcgctggcc
ggggactacccgtgggcggacgagcggccggcggcgcacggctcggtgctggtccggcgg
ctgcccgtgggcgtcgtcggggccgtcgtcccgtggaacgcaccgctgttcatcaccgcc
ctcaagctcggcccggccctggtcgcgggctgcacggtcgtgttgaagccggctccggcg
gcgccggtgtggtcctacctgttcgccgaggcggtcgtcgaggcgggcctgccgcccggg
gtggtcaacatcgtgcccgccgggaccgcggcgagcgagtacctcgtcggccatcccggc
gtcgacaaggtcaccttcaccggctcgacggcggtgggtcggcgcatcggcgaggtctgc
ggccgtgacctgcgccggtgcaccctggagctgggcgggaagtcggcggcgattctgctg
gacgacgtgtcgctgacccgccggacggtcaccacgctcaccttcggcgcgatggcgaac
tccggccaggtctgcatggcccagacccgcatcctggccccccgctcgcgctactccgag
gtggtcgacgcgctggccgagcgggtggccgcgctgcgcgtcggcgacccgaccgagccg
aagacccagatcggcccggtcatctcggcgtccgcgcgggcccggatcgaggcgcacctc
gcccgcgcgcggaccgacggcgcccgggtcgccgccggcgggggccggccggccgggctc
gaccggggctggttcgtcgagccgacgctgctggccggggtcggcaacgacgccccggtc
gcccgggaggagatcttcggcccggtggcggtggtgatcccctacgacggcgtcgaggag
gccgtcaccctggccaacgactccgactacggcctggccgggtcggtgtggagcgaggac
cccgagcgggcggggcgcgtcgccgcgcggctgcgcaccggctcggtcgccgtgaactcg
ccggcgccgctggacccgggcagcccgttcggcggaatgggcgcgtccggcatcgggcgc
gagggcggccccgagggcgtcgacgccttcgtggagctccagtcgatcatccggcccgcc
gacggctga

DBGET integrated database retrieval system