KEGG   Frankia alni: FRAAL5814Help
Entry
FRAAL5814         CDS       T00384                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fal  Frankia alni
Pathway
fal00473  D-Alanine metabolism
fal00550  Peptidoglycan biosynthesis
fal01100  Metabolic pathways
fal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FRAAL5814 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FRAAL5814 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    FRAAL5814 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fal01011]
    FRAAL5814 (ddlA)
Enzymes [BR:fal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FRAAL5814 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:fal01011]
 Precursor biosynthesis
  Amino acid ligase
   FRAAL5814 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CAJ64446
RhizoBase: FRAAL5814
UniProt: Q0RDM2
LinkDB All DBs
Position
6296488..6297591
Genome map
AA seq 367 aa AA seqDB search
MAGTRRRIRLALLFGGRSTEHAISCVSAGGVLRALDPDVYDVALVGIDPSGRWVFMPDAK
ALTPADGALPQVTASRGTSVVLAPDPTAARWYPRDGGESIQGPLGDVDVVFPLLHGPFGE
DGTIQGLLEMAGVPYVGSGVFASAAAMDKQHMKSMLQAAGLPVGPYAVVRAGQTLSEADQ
DRLGLPVFVKPARGGSSIGISRVDAWADLDTAVKTARANDPKVLVEAAITGREIECGVLG
RLDGPGAQASVPAEITVTSATGFYDFEAKYVSDQTRFDIPARLSPSALARVRQVAVAAFE
ALDCAGLARVDVFVTPDDHVVVNEVNTMPGFTPTSMFPRMWAASGITYPDLVDRLVRLAL
RDGAGLR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcaggcaccaggcgtcggattcgactcgccctcctgttcggcggccgtagcacggag
cacgcgatctcctgcgtgtctgccggcggcgtgctgcgcgcgctcgaccccgacgtctac
gacgtcgccctggtcggcatcgacccgtcggggcggtgggtcttcatgcccgacgcgaag
gccctcacgccggcagacggggcgcttccgcaggtcacggcgtctcgagggacgagtgtc
gtgcttgctccggacccgaccgcggcacgttggtacccgcgcgatggcggggagtccatc
caaggcccactcggggacgtcgacgtggtcttcccgcttctgcacggccccttcggcgag
gacgggaccatccagggtctcctcgagatggccggggtaccttacgtcggctcaggtgtc
ttcgcgagcgcggctgccatggacaagcagcacatgaagtccatgcttcaggccgcgggc
ctgcccgtcggcccgtacgccgtggtgcgggccggccagaccctgtccgaggccgaccag
gaccgcctgggcctgccggtcttcgtcaagccggcccgcggtggctccagcatcggcatc
agccgcgtggatgcctgggccgatctggacacggcggtcaagacggcccgggcgaacgac
cccaaggtcctcgtcgaggcggcgatcacgggacgtgagatcgaatgcggggtgctcggc
cggctggacgggcccggtgcgcaggccagcgtcccggccgagatcacagtcacctcggct
acgggcttctacgacttcgaggcgaagtacgtctccgaccagacccgcttcgacatcccc
gcgcgactgtctccgtcggcgctggcccgagtgcggcaggtggcggtggcggcgttcgag
gcactcgactgcgcgggactcgcgcgggtcgacgtgttcgtcaccccggacgatcacgtg
gtcgtcaacgaggtcaacacgatgcctggcttcaccccgacgtcgatgttccccaggatg
tgggcggcgagcgggatcacctatccggatctggtcgaccggctcgtgcggcttgcacta
cgtgacggcgccggactgcgatga

DBGET integrated database retrieval system