KEGG   Frankia alni: FRAAL6053Help
Entry
FRAAL6053         CDS       T00384                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fal  Frankia alni
Pathway
fal03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fal00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FRAAL6053
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fal03400]
    FRAAL6053
Enzymes [BR:fal01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FRAAL6053
DNA repair and recombination proteins [BR:fal03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FRAAL6053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAJ64677
RhizoBase: FRAAL6053
UniProt: Q0RCZ7
LinkDB All DBs
Position
6569541..6570476
Genome map
AA seq 311 aa AA seqDB search
MSDAAHQTTVEVDGRQLRLSNLDKVLYPATGFTKAQVIDYYHRISEVAVPHLADRPLTVV
RFPNGVAESSFFTKNAPSHRPDWTTTARLPSPGSTKDRSTIDYLVATDRATLVWLANLAA
LELHTPMWRISTGLPDLVVADLDPGAPATVVDCARVALLLREVLPEPLCVKTSGSKGLQV
YGRVSDGRTAMQVRADMRAVATRLERDHPDLVVANMRKDLRGGRVLLDWSQNNPAKTTVS
VYSLRGRERPTVSTPVTWAEVRGCRRPEDLVFTADEVLRRVDDHGDLFAPLRTDPSTGGR
SARPGGSDGSA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcggcgcaccagacgacggtcgaggtcgatggccgccagctccggctgtcc
aacctggacaaggtcctctatccggccaccggcttcacgaaggcccaggtcatcgactac
taccaccggatcagcgaggtcgccgtgccgcacctggcggaccggccgctgaccgtcgtc
cgcttcccgaacggcgtcgcggagtcgagcttcttcaccaagaacgcgccctcgcaccgg
cccgactggaccaccaccgcacggctgccctcgcccgggtccacgaaggaccgctcgacg
atcgactacctcgtcgccaccgaccgcgccaccctggtgtggctggccaacctcgcggcg
ctcgaactgcacaccccgatgtggcggatctcgaccgggctgcccgacctcgtcgtcgcc
gatctggacccgggcgcgccggccacggtggtcgactgcgcccgggtggccctgctgctg
cgcgaggtgctgcccgagcccctgtgcgtgaagaccagcgggtccaagggcctgcaggtc
tacggacgggtgtccgacgggcgaaccgccatgcaggtccgggcggacatgcgcgcggtg
gccacccggctggaacgtgaccatcccgacctcgtcgtcgcgaacatgcgcaaggatctg
cgtggcggtcgggtgctgctcgactggtcgcagaacaacccggccaagacgacggtgagc
gtctactcgctgcgcgggcgggaacgccccaccgtctccacgccggtgacctgggcggag
gtgcgcggctgccggcgccccgaggatctggtcttcaccgcggacgaggtgctgcggcgg
gtcgacgaccacggggacctgttcgcccccctgcgcacggacccgtccaccggcgggcga
tcggcccgaccgggtgggtcggatggttccgcgtga

DBGET integrated database retrieval system