KEGG   Ferriphaselus amnicola: OYT1_ch0058Help
Entry
OYT1_ch0058       CDS       T05631                                 

Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
fam  Ferriphaselus amnicola
Pathway
fam00061  Fatty acid biosynthesis
fam00620  Pyruvate metabolism
fam00640  Propanoate metabolism
fam01100  Metabolic pathways
fam01110  Biosynthesis of secondary metabolites
fam01120  Microbial metabolism in diverse environments
fam01130  Biosynthesis of antibiotics
fam01200  Carbon metabolism
fam01212  Fatty acid metabolism
Module
fam_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:fam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    OYT1_ch0058
   00640 Propanoate metabolism
    OYT1_ch0058
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    OYT1_ch0058
Enzymes [BR:fam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     OYT1_ch0058
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     OYT1_ch0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 GARS_A LAL_C2 Oxidored_nitro LpxI_N
Motif
Other DBs
NCBI-ProteinID: BBE49634
UniProt: A0A2Z6G8B5
LinkDB All DBs
Position
complement(56554..58020)
Genome map
AA seq 488 aa AA seqDB search
MFEKTPALQAADDGAQGSVLKRTILRAAAAAKPEPVPMFEKVLIANRGEIALRIQRACRE
MGIKTVAVHSEADADAKYVKLADESVCIGPAPSGQSYLSIPAIISAAEVTDAQAIHPGYG
FLSENADFAERVEKSGFVFIGPRAETIRLMGDKVSAKNAMKKAGVPCVPGVDGALPDDPA
EIIKIARSIGYPVIIKAAGGGGGRGMRVVHTEAALLNAVTMTKTEAQAAFNNPMVYMEKF
LENPRHIEIQILADQHGNAVYLGERDCSMQRRHQKIIEEAPAPLLNPRLRNKIGERCAEA
CRKIGYRGAGTFEFLYENGDFFFIEMNTRVQVEHPVSEMITGIDIVQQQIRIAAGEKLSF
RQKDIEFRGHAIECRINAEHPYKFIPSPGRITTWHVPGGPGIRVDSHVYANYFVPPNYDS
MIGKLIAYGDTREQALARMRTALSEMAVEGIDTNIALHQELLQDAAFIRGGTNIHYLEHK
LAEKSKVK
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaaagacccccgctcttcaagccgccgatgacggtgctcagggcagcgtgttg
aagcgcacgattttgcgtgctgccgctgccgccaagcctgaaccagtcccaatgtttgag
aaagtactgattgccaatcgaggcgaaatcgcactgcgcattcagcgcgcatgtcgcgaa
atgggtatcaaaaccgttgcggttcactccgaagccgatgctgatgcaaaatacgtcaag
ctagccgacgaatcggtgtgtattggccccgccccttcgggacaaagctacctcagcatc
ccagccattatcagcgccgccgaagtcactgatgctcaagcgatccaccccggttatgga
tttctctccgagaatgcagattttgctgagcgcgtagaaaagagtggcttcgtattcatc
ggcccacgcgcggaaaccatccgcttgatgggggataaagtatctgccaagaatgccatg
aagaaagcaggcgttccctgcgtccctggtgtcgatggtgctttgcctgacgatccagcg
gagatcatcaagattgctcgcagcatcggctacccagtcatcatcaaggccgcaggcggc
ggcggcgggcgcggtatgcgtgtagtgcatacggaagcagcgctgcttaatgcggtaacc
atgaccaagacggaagctcaggccgccttcaataatcccatggtttacatggagaaattc
ctcgaaaatccgcgtcacatcgagattcagatcctagcagaccagcacggcaacgccgtt
tacttgggtgagcgcgactgctccatgcagcgacgccaccaaaagatcatcgaagaggct
ccagccccgctgctcaatccgagattgcgcaacaagatcggtgagcgctgcgcagaagct
tgtcgcaaaatcggctatcgaggcgcgggcacgttcgagttcctgtatgagaacggagac
ttctttttcatcgagatgaatactcgcgtacaggttgagcatccggtcagcgaaatgatt
accggcattgacatcgtacagcagcagattcgcatcgccgcaggtgagaagcttagcttc
cgccaaaaggacattgagttccgtggtcacgccatcgagtgtcgcatcaatgcggagcac
ccgtataaattcatcccatcgccaggccgcatcaccacttggcacgttcctggcggacct
ggcattcgcgttgattcacatgtatatgcaaattatttcgtcccgccaaattacgattcc
atgatcggcaagctgatcgcctacggcgatactcgcgaacaggcactagcaagaatgcgt
acggctctgtctgaaatggcggtcgagggtatcgacactaatatcgcgctacatcaggag
ctattgcaagatgccgcctttattcgtggcggtacgaacatccattatcttgagcacaag
ctggccgagaaatcgaaggtcaaataa

DBGET integrated database retrieval system