KEGG   Ferriphaselus amnicola: OYT1_ch0673Help
Entry
OYT1_ch0673       CDS       T05631                                 

Definition
(GenBank) Stringent starvation protein A
  KO
K03599  stringent starvation protein A
Organism
fam  Ferriphaselus amnicola
Brite
KEGG Orthology (KO) [BR:fam00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:fam03021]
    OYT1_ch0673
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fam02000]
    OYT1_ch0673
Transcription machinery [BR:fam03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     OYT1_ch0673
Transporters [BR:fam02000]
 Other Transporters
  Pores ion channels [TC:1]
   OYT1_ch0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C Glutaredoxin GST_C_2
Motif
Other DBs
NCBI-ProteinID: BBE50240
UniProt: A0A2Z6G9R1
LinkDB All DBs
Position
689115..689714
Genome map
AA seq 199 aa AA seqDB search
MMTLYSGTTCPFSQRCRIVLFEKGMDFQIVDVDVFNKPEDIAVINPYGKVPALVERDLIL
YEANIINEYIDERFPHPQLMPADPVARARARLFLHRFEQDLFSHIPAIEHGSDKEADQAR
LAIRDGLTQIAPIFAKQKYMLGDDYSMLDVAIAPLLWRLDHYGVKLGKEAVPVMKYAERL
FARPAYFEAMTPSEKAMRK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgttgtattcagggacgacatgcccattcagccagcgctgccgcatcgtgctg
tttgaaaagggcatggacttccagatcgtagatgtagatgttttcaacaaaccagaagac
atcgcagtgatcaatccttatggcaaagtgccagctttggtggagcgggatctgatcctg
tatgaagccaatatcatcaatgagtacatcgatgagcgcttcccacatccacagctgatg
ccggcagatccagtcgctcgtgcgcgtgcgcgtttattcttgcaccgtttcgagcaggat
ttgttcagccacattcccgctattgagcacggttcggacaaagaggctgatcaagcgcgg
ctcgcgattcgggacggactgactcagatcgcccctatcttcgccaagcagaaatatatg
ctgggcgatgactactctatgcttgatgtggcgattgctccattgttgtggcgtctggat
cactatggagtcaagctgggcaaggaagctgtgccggtgatgaagtatgcggagcgctta
ttcgctcgccctgcctattttgaagcgatgactccctctgaaaaggcgatgcgcaagtaa

DBGET integrated database retrieval system