KEGG   Ferriphaselus amnicola: OYT1_ch2740Help
Entry
OYT1_ch2740       CDS       T05631                                 

Definition
(GenBank) Glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
fam  Ferriphaselus amnicola
Pathway
fam00970  Aminoacyl-tRNA biosynthesis
fam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fam00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OYT1_ch2740
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fam03029]
    OYT1_ch2740
Enzymes [BR:fam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     OYT1_ch2740
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     OYT1_ch2740
Mitochondrial biogenesis [BR:fam03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    OYT1_ch2740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BBE52246
UniProt: A0A2Z6GF73
LinkDB All DBs
Position
complement(2702708..2704162)
Genome map
AA seq 484 aa AA seqDB search
MFESSLKQLGDALRAKKISSVELTQLYLDRIAKLNPELNAYVTLNPETSLTQAREADARF
AAGTAEALTGIPIAQKDIFCAKGWLTTCGSKMLHNFVSPYDAHVISQFNNAGAINLGKTN
MDEFAMGSSNETSHYGSVKNPWDTSRVPGGSSGGTAAAVAARLCAAATGTDTGGSIRQPA
ALCGISGLKPTYGTVSRYGMIAFASSLDQAGPMGRSAEDLALLLNSMVGFDERDSTSLKR
DKEDYSRDLGKPLNGLRIGLPKEFFAEGLGNDVAQAVDAAITEYKKLGATVVDISLPNTR
LSIPVYYVLAPAEASSNLSRFDGVRYGYRAPEYTDLADMYEKSRAQGFGAEVKRRIMIGT
YVLSHGYYDAYYLQAQKIRRLIAQDFTEAFKLCDVIMGPTSPSTAFKLGEKGDDPVQMYL
SDIYTIAVNLAGLPGMSIPCGFGDNAMPVGLQIIGNYFDEARMLNVAHQYQLATDWHSRA
PQGI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatccagtttgaagcaactcggcgacgctctgcgcgccaagaaaatctccagc
gtcgagctgacccagctttacctcgaccgcatcgccaaactcaatcctgagttgaacgcg
tacgtcacgctgaatcccgagacctcgctgacgcaagcacgtgaggccgatgcccgtttc
gccgcaggaacggcggaagcgctgaccggcatccccatcgcccagaaggacatcttctgc
gccaagggctggctcaccacctgcggttcgaagatgctgcacaacttcgtgtcgccttac
gacgcacacgtcatcagccagttcaacaacgcaggcgcgatcaacctcggcaagaccaac
atggacgagttcgccatgggttcgtcgaacgagacttcgcactacggttccgtaaagaac
ccgtgggacacctcgcgcgttcccggtggttcgtccggcggtacggcggcagcggtagcg
gcgcggctgtgcgcagcggcgaccgggaccgacaccggcggctcgatccgccaaccagcg
gcgctgtgcggcatctccggcctcaagccgacttacggcaccgtgtcgcgctacggcatg
atcgccttcgcctccagccttgatcaagcgggcccgatggggcgcagcgccgaagattta
gccttgttgctcaacagcatggtcggcttcgacgagcgcgattccaccagcctgaagcgc
gacaaggaggactactcgcgtgatttaggtaagcctctgaacggcctgcgcattggcctg
ccaaaagagttcttcgccgaaggtctgggcaacgacgtggcacaagccgtggacgccgcc
atcaccgaatacaagaagctgggtgcgaccgtggtggacatcagcctgcccaacacccgt
ttgtccatcccagtctattacgtactggccccggcggaagcgtccagcaacctgtcgcgc
ttcgacggcgtgcgctacggctaccgagccccggaatacaccgacctcgccgacatgtac
gagaagagccgcgcgcagggtttcggtgcggaagtgaagcgccgcatcatgattggcacc
tacgtgctgagccacggctactacgacgcttactacctgcaagcccagaagattcgccgc
ctgatcgcgcaagatttcaccgaagcgttcaaactatgcgatgtcatcatgggcccaact
tcgccttccaccgctttcaagctgggcgagaagggcgacgatccggtgcagatgtacctg
tccgacatctataccatcgccgtcaacctggccggcctgccgggcatgtccatcccctgc
ggcttcggcgacaacgccatgccggtgggcttgcagatcatcggcaactatttcgacgaa
gcgcgcatgttgaacgtggcgcaccaatatcaactggcgaccgactggcacagccgcgcg
ccacaggggatttga

DBGET integrated database retrieval system