KEGG   Fictibacillus arsenicus: ABE41_000610Help
Entry
ABE41_000610      CDS       T04452                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
far  Fictibacillus arsenicus
Brite
KEGG Orthology (KO) [BR:far00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:far03012]
    ABE41_000610
   03029 Mitochondrial biogenesis [BR:far03029]
    ABE41_000610
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:far04147]
    ABE41_000610
Translation factors [BR:far03012]
 Eukaryotic Type
  Elongation factors
   ABE41_000610
 Prokaryotic Type
   ABE41_000610
Mitochondrial biogenesis [BR:far03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ABE41_000610
Exosome [BR:far04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ABE41_000610
  Exosomal proteins of breast cancer cells
   ABE41_000610
  Exosomal proteins of colorectal cancer cells
   ABE41_000610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ANX10539
UniProt: A0A1B1YZJ1
LinkDB All DBs
Position
118642..119832
Genome map
AA seq 396 aa AA seqDB search
MGKEKFDRSKTHANIGTIGHVDHGKTTLTAAITTVLAKKNGKGVAMAYDQIDGAPEERER
GITISTAHVEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREH
ILLSRQVGVPYLVVFMNKCDMVDDEELLELVEMEVRDLLSEYDFPGDDIPVIKGSALKAL
EGDADWEAKIYELMDAVDSYIPTPPRDTEKPFMMPVEDVFSITGRGTVATGRVERGVVKV
GDVVEILGLTEEPKSTTVTGVEMFRKLLDYAEAGDNIGALLRGVSRDDVERGQVLAKPGT
VKAHTKFKSEVYVLSKEEGGRHTPFFSNYRPQFYFRTTDVTGIIQLPEGVEMVMPGDNVE
MTVELIAPIAIEEGTKFSIREGGRTVGAGVVATITE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagagaaatttgatcgttccaaaacgcatgctaacattggtactatcggtcac
gttgaccatggtaaaacaactttaacagctgctattactactgttcttgcaaagaaaaac
ggtaaaggtgtagcaatggcttatgaccaaatcgacggtgctccagaagagcgcgagcgt
ggtatcacaatctcaactgcacacgttgagtatgaaactgattctcgtcactatgcacac
gttgactgcccaggacatgctgactatgttaagaacatgatcactggtgctgcacaaatg
gatggtgggatcctagtagtatctgctgctgacggcccaatgccacaaactcgtgagcac
atccttctttctcgtcaagtaggtgtaccttaccttgttgtatttatgaacaagtgtgac
atggtagacgacgaagaacttcttgagctagttgaaatggaagttcgtgaccttctttca
gaatacgacttccctggagacgatattcctgtaatcaaaggttctgctcttaaagctctt
gaaggagacgctgattgggaagctaaaatctacgagctaatggatgctgtagattcttat
atcccaactcctcctcgtgacactgaaaagccattcatgatgccagttgaggatgtattc
tcaatcactggccgtggcacagttgctactggacgtgttgagcgtggagtagtaaaagtt
ggtgacgtagttgagatcctaggtcttactgaagagccaaaatcaacaactgtaacaggt
gttgaaatgttccgtaagcttcttgactatgctgaagctggtgacaacattggtgcactt
cttcgtggggtttcccgtgacgatgttgagcgtggacaagttcttgctaagccaggtact
gttaaagctcacactaagttcaaatcagaagtatacgttctttcaaaagaagagggtgga
cgtcacactccattcttctctaactaccgtcctcagttctacttccgtacaactgacgta
actggtatcatccaacttcctgaaggcgttgaaatggtaatgcctggagataacgttgag
atgactgtagaactaatcgctccaatcgctatcgaagaaggaactaagttctctattcgt
gaaggtggacgtacagttggtgcaggtgtagttgcaacaatcactgagtaa

DBGET integrated database retrieval system