KEGG   Fictibacillus arsenicus: ABE41_001165Help
Entry
ABE41_001165      CDS       T04452                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
far  Fictibacillus arsenicus
Pathway
far00473  D-Alanine metabolism
far01100  Metabolic pathways
far01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:far00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    ABE41_001165
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    ABE41_001165
Enzymes [BR:far01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     ABE41_001165
Peptidoglycan biosynthesis and degradation proteins [BR:far01011]
 Precursor biosynthesis
  Racemase
   ABE41_001165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ANX10638
UniProt: A0A1B1YZM1
LinkDB All DBs
Position
200185..201357
Genome map
AA seq 390 aa AA seqDB search
MDRNHFYRDTWAEINLDKISSNIKSFKKHLPDQKIMAVVKANGYGHGAYQTAVEALESGA
ELLAVAMLDEALALRKQGISAPILVMNRIRPEYVSLAAENEISITIFQKDWLIEASKFLK
ETDKVLNIHLKLDTGMGRVGITEEEELHDVSLLIQNSSACEIEGVFTHFATADEWESELF
ETQRKRFINQLDLLKKWGITPKYVHSANSAAALRKFEGPFNLVRLGISMYGLSPSSEMKE
KLPFTLEEAFSLHSQLIHVKKLMPGDTVSYGATYRAKEEEWIGTLPIGYADGWQRRLSPG
ADVLIRGERAPIIGRICMDQCMVKLPYKMDVGEKATLIGKQNDETIEMDEIASLAKTINY
EIPCLISSRVPRVFVKKGRISENMNVILNF
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtggacagaaatcacttttatagagatacatgggcagaaattaacctagataaaatcagc
agcaacataaaatcatttaaaaaacatcttcccgatcaaaaaattatggcagtcgtgaaa
gcgaatggctatggtcatggagcgtaccagactgcagttgaggcgcttgaatcaggagct
gaactgcttgctgtagccatgctggatgaagcattggctttaagaaaacaagggatttca
gcaccgattctggttatgaaccgtatacgtcctgaatatgttagtcttgcggcggaaaat
gagataagcataaccatattccaaaaagattggcttatagaagcttcgaagtttcttaaa
gaaaccgataaagtattaaacattcacttaaaacttgatacaggtatgggccgagtgggt
attacagaagaagaggagcttcatgatgtttctcttttgatacagaattcttctgcctgt
gaaatagaaggtgtttttactcatttcgcaacagcagatgaatgggaatctgaactgttt
gaaacccaaagaaaaagatttattaatcaattagacttactgaagaagtggggaattacg
ccgaaatacgttcacagcgccaacagtgccgcagcattgcgtaaatttgaaggacctttt
aatctcgtgagattgggaatcagcatgtatggtttatctccatcatcagaaatgaaagaa
aagctcccttttactttagaagaagctttcagcctgcattctcagctgatacatgttaaa
aaactgatgcctggggatactgtaagttacggagcaacttatagagcgaaagaggaagag
tggataggcacccttccgatcgggtatgcagatggctggcaaagaagattatcgccaggt
gctgatgtgctgatccggggtgagcgtgcacctattatcggccgaatctgtatggatcaa
tgcatggtaaagcttccttataaaatggatgttggtgaaaaagctaccttaataggcaag
cagaatgatgaaacaattgaaatggatgaaatcgcttctctagcaaaaaccataaattat
gagataccgtgtttaatttcttcacgagtgccgagagtttttgtgaaaaagggtcgaatt
tcagaaaatatgaatgtaattctaaatttttag

DBGET integrated database retrieval system