KEGG   Fictibacillus arsenicus: ABE41_007115Help
Entry
ABE41_007115      CDS       T04452                                 

Definition
(GenBank) hypothetical protein
  KO
K02250  competence protein ComK
Organism
far  Fictibacillus arsenicus
Pathway
far02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:far00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ABE41_007115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:far03000]
    ABE41_007115
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:far02044]
    ABE41_007115
Transcription factors [BR:far03000]
 Prokaryotic Type
  Other transcription factors
   Others
    ABE41_007115
Secretion system [BR:far02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) related proteins
   ABE41_007115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComK
Motif
Other DBs
NCBI-ProteinID: ANX11774
UniProt: A0A1B1Z2Z7
LinkDB All DBs
Position
1341796..1342290
Genome map
AA seq 164 aa AA seqDB search
MEKTMLLGSYEINTSTMALLPFYNEFGVVHTEILESEKNERVALSPIKIINESCLFFGSS
YEGRREAVRRSMGYVSLSPIMINLELGIFFFPVESPKNETCIWLSQSHVQRIEAVDSDTC
SVHFKNTANLILPQSKHALEAKLFRTAQYRYILSERVSERNMRY
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacaatgcttctaggttcctacgaaattaacacaagcacaatggcactttta
ccgttttacaatgagttcggagtagtgcataccgaaatattggaatcggaaaaaaatgaa
agagtcgcactcagtcctatcaaaattatcaatgaaagctgcttgttcttcggctccagt
tatgaaggcaggcgagaagctgtccgccgctcaatgggctatgtgagtttatccccaatc
atgatcaacctcgaattaggcattttcttttttcccgtagaatcacctaaaaacgaaaca
tgcatctggttatcacagtcacacgtgcagcgaatcgaagccgttgactccgatacatgc
agtgtccactttaagaacaccgcaaacctgatcttaccccaatcgaagcatgcattagag
gcgaaactgttccgtaccgcgcaataccgatatatattaagtgaacgagtgagtgaaaga
aatatgagatattaa

DBGET integrated database retrieval system