Fictibacillus arsenicus: ABE41_007525 Help Entry ABE41_007525      CDS       T04452                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism far  Fictibacillus arsenicus Pathway far02020   Two-component system far02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:far00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     ABE41_007525  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     ABE41_007525  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:far02035]     ABE41_007525 Bacterial motility proteins [BR:far02035]  Flagellar system   Flagellar assembly proteins    Others     ABE41_007525 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ANX11855 UniProt:  A0A1B1Z2Z2 LinkDB All DBs Position 1416522..1416779 Genome browser AA seq 85 aa AA seqDB search MRIDGQQPVQRKYDVNKMYQQPSVKPPSFAKDELYISNEAKALNDHAQLNIREKKLLDIK KRIDAGEYQINANEIAKKISQFYSI NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgagaattgatggacagcaaccggtacaaagaaaatacgatgtaaacaaaatgtatcag cagccttctgttaagcctccgtcatttgccaaagacgaactttacatatcaaacgaggca aaagcattgaatgatcatgctcagttaaacataagagaaaagaaacttttggatataaaa aaacgcattgatgctggagagtaccagatcaatgcgaatgaaattgcaaaaaagatttca cagttttactcaatttaa

DBGET integrated database retrieval system