KEGG   Fictibacillus arsenicus: ABE41_009560Help
Entry
ABE41_009560      CDS       T04452                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
far  Fictibacillus arsenicus
Brite
KEGG Orthology (KO) [BR:far00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:far03036]
    ABE41_009560
Chromosome and associated proteins [BR:far03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    ABE41_009560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N SMC_hinge AAA_23 AAA_15 AAA_21 AAA_29 SbcCD_C ABC_tran
Motif
Other DBs
NCBI-ProteinID: ANX12255
UniProt: A0A1B1Z410
LinkDB All DBs
Position
1829645..1833211
Genome map
AA seq 1188 aa AA seqDB search
MFLKRIDVAGFKSFAERIQVEFVQGVTAVVGPNGSGKSNISDAVRWVLGEQSAKSLRGSK
MEDIIFAGSDNRKPLNVAEVTLTLDNEDQHLPLDYNEISITRRVYRSGDSEYLINKQQCR
LKDIVELFMDSGLGREAFSIIGQGRVEEILSSKSEERRKIFEEAAGVLKYKTRKQKAEQK
LFETQENLNRVEDILHELEGQVEPLKIQASIAKDYLEKKQELEVVETAVLVQEIEDLHER
WEKQKTWVAELQKQESELSVKVKQGESAIERARLDMQAMDESIDELQGALLSASETLEKL
EGKKEVLKERKKNYDQNKTSLLEQIQQLKVKKEQLETQLLSEKSILADKEKQLKTVRKQV
TEEESRLTVLEMDVEAELEKLKSDYFERLNEQTTIKNEMRYIEDQSKQQNFKSSRLDEEN
NRYLHQREELKKTKEQAEQSYKEAETQLKKKQEEYQNLKSAVSLEEQESRSSQEKLYQAY
QYIQQFKSKKEMLESMQDEYAGFMQGVKEVLKAKETRLSGIEGAVAELLSVPSEVETAIE
TALGASMQHVVVDHEQNAMKAIQFLKQTRAGRATFLPLNVIKSRNVSSADVHNARTVDSF
VGVAADLVHFDQKYKNIVGNLLGNIIISKDLAGANAIAKQVNYRYRIVTLEGDVVSPGGS
MSGGSLKQKSSSLLSRQREVEVLTEKLAAMEKQTLSLEEKVTNLKAKVTKNKEALDNLQA
EGEKLRELEQELKSNLREIEIQEKSLNDRLQLYDREKHTFESERSAADTRLMNLKKRLDK
AVKSGSELEKTIADLTEKKKMHQSSKEELRETLTQLKIKTAELEQQVANLKEKSLRLEEE
FAGVSAKSKETEEDYWLLEEEMNSSSSGEDSLDEQIKQKRHEKNTALKLIAERRQERTES
FRSIEKMEIELKEAKRQYKQLSDGLRTEEVSINRLDVELETRLTHLREEYELSYEGAKQK
HKLEMPLEDAKRKVKLIKMAIEELGVVNIGAIEEYDRVSQRFNFLTEQRDDLTEAKNTLY
GVISEMDEEMKNRFEETFTAIRSHFGVIFKELFGGGRADLVLTQPDDMLATGVDIMAQPP
GKKLQQLGLLSGGERALTAIALLFAILKVRPVPFCILDEVEAALDDANVNRFAKYLRAFS
KETQFIVVTHRKGTMEEADVLYGVTMQESGVSKLVSVRLEETKELVTS
NT seq 3567 nt NT seq  +upstreamnt  +downstreamnt
atgttcctcaaacgaattgatgtagcaggatttaaatcatttgcagagcggatacaagta
gaatttgttcagggagtaactgctgtagttgggccgaacggaagcggaaaaagcaatata
tcagatgctgtaagatgggtgcttggcgagcagtctgccaagtcgcttcgcggctctaag
atggaggatatcatttttgccggcagcgataatcgcaaaccgttgaatgtcgctgaagtc
actctcactttagataacgaagaccagcatcttcctcttgattataatgagatttctatt
acaagaagagtttatcgctcaggtgatagtgaatacttaatcaataagcagcaatgccgc
ttaaaagacattgttgaattatttatggactctggacttggaagagaagctttttctatt
attggacaaggccgggtagaagaaattttaagcagtaaatctgaagagagaagaaaaatc
tttgaagaagccgcaggagttttaaaatataaaacaagaaaacaaaaggctgaacaaaaa
ctatttgaaactcaggaaaacttaaacagggttgaagatatccttcatgaacttgaaggg
caggttgaacctctaaaaatacaggcatctattgcgaaggattatcttgagaagaaacag
gaattagaggtcgttgagactgctgttctcgttcaggagatagaagaccttcacgaacgc
tgggaaaaacaaaaaacatgggtggcagaactacagaaacaagaatctgaactttccgta
aaagttaagcagggtgaatctgcgattgaaagagccagacttgatatgcaggcgatggat
gaatctattgatgaacttcagggagctcttctatcagcaagtgaaacgctggaaaaactt
gaaggaaaaaaagaagttttaaaagagagaaagaaaaactatgatcagaataaaacttca
cttttagagcagattcagcaactgaaagtaaaaaaagaacaactagaaacacaattgctc
tcagagaaaagtattttagcagataaagaaaagcaattaaaaacggttcgaaaacaagtt
actgaggaagaaagccgtttgactgtccttgaaatggatgtggaagcagagcttgaaaaa
ctaaaaagtgattattttgaacgcctaaatgaacaaacgactatcaaaaatgaaatgcgt
tatattgaggatcagtctaaacagcaaaactttaaaagcagcagattggatgaagaaaac
aatagatatcttcatcaaagggaagaattaaagaagacgaaagaacaggctgagcagagc
tataaagaagctgaaactcaactgaagaagaaacaggaagagtatcagaacttaaaatcc
gctgtttctttagaagaacaagaaagccgttcaagtcaagagaaattgtatcaggcttat
cagtatatccagcaatttaaatcaaagaaagaaatgctagaatcgatgcaggatgaatat
gccggatttatgcagggagtaaaagaagtattaaaggcaaaggagacgaggttatctgga
attgaaggtgccgtagccgaacttctttctgttccgtctgaggttgaaaccgctattgag
acagctttaggggcttctatgcagcatgttgttgtcgatcacgaacagaacgcaatgaaa
gccatccaattcttaaaacaaacaagagctggcagagcaacattcttaccgttaaacgta
attaaaagccgcaatgtttcgagtgcggatgttcataatgcacgcacagttgattctttt
gttggagtcgcagctgacctcgtgcattttgatcaaaagtataagaacatagttggaaac
ttattaggaaacattataatttccaaggatctagctggagcaaatgcgattgcaaagcaa
gtgaactatcgctatcgaatagttacccttgaaggggatgttgtcagcccaggcggttca
atgtctgggggaagcctcaaacagaagagttcctctcttttaagcagacaaagagaagtt
gaagtactgactgaaaaattagctgcaatggagaaacaaactcttagcttagaagaaaaa
gttactaatctaaaagcaaaagttacaaaaaacaaagaagcattagacaatcttcaagct
gaaggtgagaaactaagagaacttgaacaagaactcaaaagtaacctgcgtgagattgag
attcaagaaaagagtttaaacgacaggctgcaattgtatgatcgtgaaaaacatacattt
gagtctgagcgttcggccgctgacacgagattaatgaatcttaagaagaggcttgataaa
gctgtgaaatctggcagtgaactggagaaaacaatcgcagacctaactgaaaagaagaag
atgcatcagtcttctaaagaagagcttagagaaactttgacacaattaaaaattaaaact
gccgagcttgaacagcaagtggcaaatcttaaagaaaaaagtctgcggctcgaagaagag
tttgcaggtgtaagtgctaaaagcaaggaaacagaggaagattactggcttcttgaagaa
gaaatgaattcaagttcgtcaggagaggattctctcgatgaacagattaagcaaaagaga
catgaaaaaaatactgcattaaaactgatagctgaacgcagacaagaaagaacagagtca
ttccgctctatcgaaaaaatggaaattgagcttaaggaagcgaagcgccaatacaaacaa
ttgagtgatggattaagaacggaagaagtgagcataaacagacttgatgtggaacttgaa
acccgtctgacccatctccgggaagagtatgaactgtcatatgaaggtgctaagcaaaaa
cacaaacttgagatgccgttggaagatgctaaacgaaaagtaaagctgatcaaaatggcg
atcgaagagctgggtgttgtcaatatcggtgccattgaagaatatgacagagtcagtcag
cgttttaatttcctaacagaacaaagggatgacctgacggaagctaaaaatacactgtat
ggcgtaatttctgagatggatgaagaaatgaaaaatcgttttgaagagacgttcacagcc
atccgatcgcatttcggggtcatcttcaaagagttattcggaggcggccgagcagacctt
gtgctgactcagccagacgacatgcttgcaacaggtgttgatataatggcgcagcctcct
ggtaaaaagcttcagcaactagggttgttatctgggggagagcgtgctttaactgcaata
gcactactctttgccatccttaaggtgcgtcctgttccattttgtattttggatgaagta
gaagccgcattagatgatgcaaacgtgaaccgttttgcaaagtatttgcgggcattcagc
aaagaaacacagtttatcgttgtaacccatcgaaagggtacaatggaggaagccgacgta
ttgtatggggtgaccatgcaggaatcaggcgtttcaaaacttgtttcagtacgcttagaa
gaaactaaagaactggtaacatcgtag

DBGET integrated database retrieval system