KEGG   Fictibacillus arsenicus: ABE41_013700Help
Entry
ABE41_013700      CDS       T04452                                 

Definition
(GenBank) hypothetical protein
  KO
K06370  morphogenetic protein associated with SpoVID
Organism
far  Fictibacillus arsenicus
Brite
KEGG Orthology (KO) [BR:far00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    ABE41_013700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysM
Motif
Other DBs
NCBI-ProteinID: ANX13060
UniProt: A0A1B1Z6J5
LinkDB All DBs
Position
complement(2645311..2646921)
Genome map
AA seq 536 aa AA seqDB search
MRIHIVQKGDTLDKIAEKYDVPVNELRKANPGFSRTDVIERGEKIKIPIKMPGVKKEAPI
KEQPKPMAPVQEAPVAPVQEKPKPAPVKPAPMKPAPAKKEMKPAPMKPAPAKKEMKPAPM
KPAPAKKEMKPAPMKPSPKMEYKDAPMKKDTYTAPMKAPMAPLHDKDFAGMMESSNLGHY
VPMGYPNAANQPNMANQPNMANQPNIANQPNIANQPNIANQPNIANQPNIANQPNVSGKH
GLYPSGKDSYQPNKHPFLMEESSGMMQNMYGSMPPMFPKPQTYSPIPQGYGMMPPQGFSG
MPQLYGGGYPQGGQQGTGMQQGGMPFGEFPDSDMDLMPAGEYTPWGQQSQQGMPMGMQQM
GMPGGDMSQMGQMGMQPMGMMPEMPQMGQMGMMPGMPQMGQMGMMPGMPQMGQMGMMPGM
PQMDQMGMMPGMPQMGQMGMMPGMPQASQMGMMPGMPQMGQMGMMPQQNGGSPMGMMPSM
PQMGQMGIPQNGGMPQMGQMGMMPQGQGMVNMPNPYSQAQYRDSEQGDAEESEENE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgagaattcacattgtgcaaaaaggggacacacttgacaaaatagctgaaaaatatgat
gttcctgtgaatgaactaagaaaagcaaatcctggtttttctagaacggatgtaatcgag
cggggggaaaagattaagatccctataaaaatgccgggagtaaagaaagaagcacctatt
aaggaacagcctaaacctatggctcctgttcaagaggcacctgttgcacctgttcaggaa
aaaccaaagcctgcgccggtaaaaccagcgccaatgaaaccagcaccagcaaagaaagaa
atgaagccggcgccaatgaagccagcaccagcaaagaaagaaatgaagccggcgccaatg
aagccagcaccggcaaaaaaagaaatgaagcctgcacctatgaaaccatcaccaaagatg
gaatataaagatgctccaatgaaaaaagatacctatactgctccaatgaaagcgccaatg
gctcctttgcatgataaagattttgcaggaatgatggaatcttcaaaccttggtcattat
gttccaatgggctatcctaatgcagcaaaccagcctaatatggctaaccagcctaatatg
gctaaccagccaaacattgcgaatcagccaaacatagcaaatcagccaaacatagcaaat
cagccaaatatagcaaatcagccaaacattgcaaatcagccgaatgtttcaggtaagcat
ggtttatatccttccgggaaagacagctatcaaccgaataaacatccatttttgatggaa
gaatcttcaggaatgatgcaaaatatgtatggttcaatgccgccgatgtttcctaaaccg
caaacatattcacctattccgcaaggctatggaatgatgcctccgcaaggattcagcgga
atgccgcaactgtatggcggcggataccctcagggtggtcagcaaggtacaggaatgcag
cagggcggaatgccttttggtgaatttccagactccgatatggatctaatgccagctggt
gaatataccccatggggacagcaatcccagcaaggtatgccgatgggaatgcagcaaatg
ggtatgccaggcggtgatatgtcacaaatgggtcaaatgggaatgcagccaatgggtatg
atgcctgaaatgccacagatgggtcagatgggtatgatgccgggaatgcctcaaatgggc
cagatgggcatgatgccgggaatgcctcaaatgggccagatgggcatgatgccgggaatg
cctcaaatggaccagatgggtatgatgccaggaatgcctcaaatgggccagatgggtatg
atgccaggaatgcctcaagcgagccagatgggtatgatgccaggaatgcctcaaatgggt
caaatgggtatgatgccgcagcagaatggcgggtcgccaatgggtatgatgccaagtatg
cctcaaatgggccagatgggaattcctcaaaacggcggaatgccgcagatgggtcaaatg
ggaatgatgccacaaggccaaggtatggttaatatgccaaacccttattctcaagcacaa
taccgtgattctgaacaaggtgatgcagaggaatcggaagaaaatgaatag

DBGET integrated database retrieval system