KEGG   Fictibacillus arsenicus: ABE41_014300Help
Entry
ABE41_014300      CDS       T04452                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
far  Fictibacillus arsenicus
Pathway
far00020  Citrate cycle (TCA cycle)
far00480  Glutathione metabolism
far01100  Metabolic pathways
far01110  Biosynthesis of secondary metabolites
far01120  Microbial metabolism in diverse environments
far01130  Biosynthesis of antibiotics
far01200  Carbon metabolism
far01210  2-Oxocarboxylic acid metabolism
far01230  Biosynthesis of amino acids
Module
far_M00009  Citrate cycle (TCA cycle, Krebs cycle)
far_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:far00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE41_014300
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ABE41_014300
Enzymes [BR:far01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ABE41_014300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ANX13176
UniProt: A0A1B1Z736
LinkDB All DBs
Position
complement(2775384..2776652)
Genome map
AA seq 422 aa AA seqDB search
MSNGERITVDNGVLNVPNQPIIPFIEGDGTGPDIWAAASRVLEAAVEKAYNGEKKIVWKE
VLAGEKAFNQTGEWLPSETLDVIRDYIIAIKGPLTTPVGGGIRSLNVALRQELDLFTCLR
PVQYFKGVPSPVKRPEDTNMVIFRENTEDIYAGIEYASGSDEVKKLIQFLQDEMGVNKIR
FPETSGIGIKPVSSEGTQRLVRAAIQYAINEGRKSVTLVHKGNIMKYTEGAFKNWGYELA
EAEFGDKVFTWAQYDRIAEESGKDAADKAQADAEAAGKIIVKDSIADIFLQQILTRPAEF
DVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHGTAPKYAGLDKVNPS
SVILSGVLMLEHLGWGEAAKLVLSSMEHTIASKVVTYDFARLMDGATEVKCSEFADELIK
NM
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtctaacggagaacgtattacagttgacaacggagtgttgaatgtaccaaaccagccg
attatccctttcatcgaaggtgacggaactggaccagatatctgggctgctgcttcaaga
gtattagaagctgctgttgaaaaagcatataacggtgagaaaaagattgtttggaaagaa
gttcttgctggagaaaaagcatttaaccaaacgggagaatggcttccatcagagacttta
gatgttattcgtgattacataattgcgattaaaggacctttaactacaccagtcggcgga
ggaatcagatctctaaacgtagcactaagacaagaattagatttattcacttgcttacgt
cctgttcaatatttcaaaggtgtaccttcaccggtaaaacgtcctgaagatactaacatg
gttatcttccgtgagaatactgaagatatttatgcaggtatagaatatgcgagcggttct
gacgaagtgaaaaagcttattcaattccttcaagatgaaatgggtgttaacaaaatccgt
ttccctgaaacatcaggaattggtattaagcctgtatcttctgaaggtacacagcgtcta
gtgcgtgctgcgatccaatatgcgatcaacgaaggccgcaagagtgtaacacttgttcac
aaaggaaacatcatgaaatacactgaaggagcttttaaaaactggggttatgagctggca
gaagctgaattcggtgacaaagtattcacttgggctcaatatgaccgtattgctgaagaa
agcggcaaggatgcagctgacaaagcacaagctgatgcagaagctgcaggcaagatcatc
gttaaggattcaatcgctgatatcttcttacagcagattcttactcgtccagctgaattt
gacgtagtagcaacaatgaacctgaacggtgactatatttctgatgctcttgctgctcaa
gttggcggaatcggaattgctcctggagcaaacatcaattacgaaacaggacatgctatt
tttgaagcaactcacggtactgcaccgaagtatgcaggtcttgataaagtaaacccttca
tctgtaatcctttcaggtgtactaatgttagaacacttagggtggggagaagcagctaaa
ctagttctttcatctatggaacatacaattgcaagtaaagtagtaacatatgactttgca
cgtttgatggatggtgctacagaagttaaatgttctgagtttgcagacgaactaattaaa
aatatgtaa

DBGET integrated database retrieval system