KEGG   Fictibacillus arsenicus: ABE41_016965Help
Entry
ABE41_016965      CDS       T04452                                 

Definition
(GenBank) hypothetical protein
  KO
K02240  competence protein ComFA
Organism
far  Fictibacillus arsenicus
Brite
KEGG Orthology (KO) [BR:far00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:far02044]
    ABE41_016965
Secretion system [BR:far02044]
 Type II secretion system
  Competence-related DNA transformation transporter (DNA-T) core components
   ABE41_016965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Helicase_C ResIII DEAD Flavi_DEAD AAA_19 HypA AAA_30
Motif
Other DBs
NCBI-ProteinID: ANX13702
UniProt: A0A1B1Z8B4
LinkDB All DBs
Position
complement(3306912..3308408)
Genome map
AA seq 498 aa AA seqDB search
MRFVSYFLNDRLIVAPETLVENLDFTPVPFGELPQIEPQLLNSSFKYDEKLQQVLYGKML
LFDELQLPLKTIQEHFENGFVMYNQGVIKTKYGWQCKRCGNEKYHLFASFSCFRCKSENC
VYCRNCIMMVRVSVCSPLLSWIGPDVKHKSDHQLMWRGELSAGQQIASDCFVEQVGNSGE
LLIWAVCGAGKTEVLFHGIEKALKMGLRVCIATPRTDVVLELAPRIKEAFPNTLIVSYYG
GSKERETPAQLVISTTHQLYRFKQAFNLMIVDEVDAFPYSYDKTLQHAVSGSVRNDALRL
YLSATPSGKMKKQVTQNKLPCVKIPIRFHGFPLPEPKMVWSGEWKKRLERGKLPPAFLKW
IKSQVVSERRAMIFVPSVSIIEKVTELIRGHVEVIVDFVHAEDPLRKDKVARFRQGDIQL
LVTTTILERGVTVPFLDVVIFGADHEVFSESALVQMAGRAGRSKDDHNGQVLFFHYGKSL
SMLNAIKHIRHMNEEAGF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaggtttgtctcctattttttaaacgatcgtttaatagttgctcctgaaacacttgta
gaaaacctcgatttcacgccagttccgtttggggaacttcctcaaatagaaccccaactt
ctgaattcctcgtttaagtatgatgaaaaactccagcaagtcctctatggaaagatgctt
ctttttgatgaacttcaacttcctttaaaaacaatacaagaacattttgagaatggtttt
gtcatgtacaaccaaggtgttataaaaaccaaatatgggtggcaatgcaaacgatgcggc
aatgaaaaatatcatttgtttgcttctttttcctgttttcgatgtaaaagcgaaaactgt
gtatattgccgtaactgcattatgatggtaagagtaagtgtgtgttcgcctcttttatcc
tggataggtccagatgtgaaacataaatcagatcatcagttaatgtggcgaggggaactt
tccgcaggacagcaaattgcttctgattgttttgttgaacaagttggcaatagtggagaa
ctattaatttgggcagtatgtggagcgggaaaaactgaagttctatttcatggaatagaa
aaagcattgaagatgggattacgggtttgcatcgcaacaccacgtactgatgtcgtttta
gaactcgcaccccgtataaaagaggctttcccaaatactttgatcgtcagctattatggc
ggatctaaagaaagagaaacacccgcacaattagttatctcaaccacgcatcagctctac
agatttaaacaagcgtttaatcttatgatcgttgatgaagtcgatgcttttccatattcc
tacgataagactcttcagcatgcagtttcaggttccgtgcgaaatgatgctcttcgcctt
tacctttcagcaaccccctccggaaagatgaaaaaacaagtcactcaaaacaaactaccg
tgtgtaaaaataccgatccgatttcacgggtttcctctgcctgaaccgaagatggtatgg
agtggagagtggaagaagcgtttagaaagaggaaagttacctcctgcttttttgaaatgg
attaaatcgcaagttgtcagtgaaagacgggcaatgattttcgtgccttctgtatccatc
attgaaaaagtaactgaactgataagagggcatgttgaagtaatcgtcgattttgttcat
gcagaagatccactaagaaaagataaagtagcaaggtttcggcaaggtgatatacagctt
ttagttacaacgacgattttagagcggggtgtaactgtaccatttttagatgtagtaatt
ttcggggctgatcatgaagtgttctctgaaagtgcacttgttcaaatggcaggcagagca
ggtagaagtaaagatgatcacaatggacaggtactcttttttcattacggcaaatctctg
agtatgttgaatgcaataaaacatattaggcacatgaatgaggaggcgggattttga

DBGET integrated database retrieval system