KEGG   Flavobacterium arcticum: DVK85_03190Help
Entry
DVK85_03190       CDS       T05621                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fat  Flavobacterium arcticum
Pathway
fat00380  Tryptophan metabolism
fat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DVK85_03190 (kynU)
Enzymes [BR:fat01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DVK85_03190 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 SHMT DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AXG73284
UniProt: A0A345H9M4
LinkDB All DBs
Position
complement(685338..686618)
Genome map
AA seq 426 aa AA seqDB search
MDFKNTREFAQQLDAQDKLAKYRDEFNFPHINGKQVIYFTGNSLGLQPKRTKAYVDEVMN
DWAKLAVEGHFFADKPWWDYHERFAQPLSKVVGALPSEVTVMNTLTVNLHLLMVSFYNPK
PNRYKIICEEKAFPSDQYMIKSQVHFHGYDPDDAIIEIKRRDGEHNIRTEDVLNVIKEAG
DELALVLIGGVNYYTGQVFDMETITKAGQEAGAYVGWDLAHAAGNIHLDLHKWNVDFAAW
CSYKYMNSGPGNASGAFVHEMHHNDMDLPRFAGWWGHNKERRFLMEPQFDPVRGADGWQI
SNLPILSLAPYLASVEMFDEVGMPALIQKRDHITSYLEFILHEIDKDVDSTFEIITPSNP
KERACQLSVFLHGEGKALFDYLMENGVITDWREPNVIRLAPVPLYCSYEDMYEFGQVLKK
GILSHK
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggattttaagaatacacgcgaatttgcacagcaacttgatgcacaagataaactggct
aagtatcgggatgaatttaactttccgcatataaacggcaagcaagtaatttattttaca
ggaaactcgttagggttacaacccaaaagaacaaaagcctatgtagatgaggtaatgaac
gactgggctaaacttgctgtagaaggacatttttttgccgataaaccttggtgggattac
catgagcgttttgcacaaccactaagtaaagtagtaggagcgttgcctagtgaggttaca
gttatgaatactcttacggtaaatttacatttgttaatggttagtttttataaccctaaa
cccaatagatataaaattatttgcgaagaaaaagcctttcctagcgaccagtacatgata
aaaagtcaagtgcattttcatggatatgatcctgatgatgccattatagaaataaaaaga
cgagatggcgaacataatattcgaacagaagacgtattgaatgttataaaagaagcaggc
gatgagctagcacttgttcttataggtggagtaaattactatacaggtcaggtttttgat
atggaaacgataaccaaagcaggacaagaagcaggagcttatgtaggctgggatttggca
catgctgcgggtaatatacaccttgatttacacaaatggaatgtagattttgctgcatgg
tgtagttataaatatatgaattcaggaccaggtaatgcatcgggcgcatttgtacacgaa
atgcatcataatgatatggatttaccacgttttgcaggttggtggggacataataaagaa
cgccgctttttaatggagccacagtttgatcctgtacgtggtgcagatggctggcaaatt
agtaacctacccatactatcgcttgcaccttatctagcttcggtagaaatgtttgacgaa
gtaggtatgcctgcattaatacagaaaagagaccatataacctcatatcttgaatttata
ctacatgaaattgataaagatgtagatagtacttttgagattataacaccatctaaccct
aaagagagagcctgtcaattatcagtatttttacatggagagggtaaagcattatttgat
tatttgatggagaatggtgtaataaccgactggagagagccaaatgtaatacgacttgca
ccagtgccattatactgctcttatgaagatatgtatgagtttggtcaggtattaaagaag
ggaattttatcgcataaataa

DBGET integrated database retrieval system