KEGG   Frateuria aurantia: Fraau_1156Help
Entry
Fraau_1156        CDS       T01773                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
fau  Frateuria aurantia
Pathway
fau00020  Citrate cycle (TCA cycle)
fau00270  Cysteine and methionine metabolism
fau00620  Pyruvate metabolism
fau00630  Glyoxylate and dicarboxylate metabolism
fau00680  Methane metabolism
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
Module
fau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fau_M00012  Glyoxylate cycle
fau_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fraau_1156
   00620 Pyruvate metabolism
    Fraau_1156
   00630 Glyoxylate and dicarboxylate metabolism
    Fraau_1156
  09102 Energy metabolism
   00680 Methane metabolism
    Fraau_1156
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Fraau_1156
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Fraau_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: AFC85615
UniProt: H8L421
LinkDB All DBs
Position
1247684..1248670
Genome map
AA seq 328 aa AA seqDB search
MKAPVRVAVTGAAGQIGYALLFRIAAGDMLGKDQPVILHLLEITPALPALQGVVMELNDC
AFPTLAGVVTSDDPNVAFKDVDYALLVGSRPRGPGMERKDLLEANGAIFGPQGKALNDHA
KRDVKVLVVGNPANTNALIAQQNAPDLDPKCFTAMVRLDHNRGLSQLAEKTGKHSSDVKK
FTIWGNHSSTQYPDLHHTLVDGKPALELVDQSWYEKDFIPTVQQRGAAIIKARGASSAAS
AASAAIDHIRNWALGTAEGDWVSMGIPSDGSYGIKPGVIFGYPVTVKNGKYEIVQGLAIN
AFSQAKLDATEKELFEERAAVEHLFAGK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcccccgttcgtgttgccgtgaccggcgccgccggccagattggatatgccctg
ctgttccgcattgctgcgggcgacatgctgggcaaggaccagccggtcatcctgcacttg
ctggaaatcaccccggcgctgcctgccctgcagggtgtggtaatggaactcaacgattgc
gctttcccgactttggccggggtggtgacctcggatgatccgaatgtcgctttcaaggat
gtcgattacgccctgctggtcggctcgcgtccgcgtggcccgggcatggagcgcaaggat
ctgctggaggccaacggcgccatcttcggcccgcagggcaaggccctgaatgaccatgcc
aagcgcgatgtgaaggtgctggtggtcggcaatccggccaataccaatgctctgatcgcc
cagcagaatgcgccggatctggatccgaagtgctttaccgcgatggtgcgccttgaccac
aaccgcggcctcagccagctggccgaaaagaccggcaagcacagcagcgatgtcaagaag
ttcacgatctggggcaatcacagctcgacccagtatccggatctgcaccacactctggtc
gacggcaagccggcgctggagctggtggatcagtcctggtatgaaaaggacttcatcccc
accgtgcagcagcgtggcgcagccatcatcaaggcccgtggtgcctcctcggcggcctcg
gccgcctcggctgcgattgatcatatccgcaactgggcgctgggtacggccgagggcgac
tgggtgtcgatgggcattccctcggatggttcctacggcatcaagccgggcgtgatattc
ggctatccggtgacggtcaagaacggcaagtacgagatcgtgcaaggtctggccatcaat
gcgttctcgcaggccaagctggatgccaccgagaaagaactgttcgaagagcgcgctgcc
gtcgagcatctgttcgccggcaagtaa

DBGET integrated database retrieval system