KEGG   Frateuria aurantia: Fraau_2040Help
Entry
Fraau_2040        CDS       T01773                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fau  Frateuria aurantia
Pathway
fau00380  Tryptophan metabolism
fau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    Fraau_2040
Enzymes [BR:fau01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     Fraau_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AFC86424
UniProt: H8L2R5
LinkDB All DBs
Position
2167881..2169161
Genome map
AA seq 426 aa AA seqDB search
MSEYRSDPAWAAAADAADPLRHCRDAFLIPPHGASDSHYFCGHSLGLQPRQTAAELQQEL
QDWASLGVEGHFKGRRPWLDYHRRLTRPLAGLVGARDDEVVAMNSLSVNLHLLMVSFYRP
TAERPAILIEAGAFPSDRYAVESQIRFHGLDPAKALIELHPDQADGSFSDQAICEAFAEH
GPKLALALLPAVQYRTGQAFPLADISRWAHAQGCLVGFDLAHAVGNLDLQLHASEVDFAV
WCSYKYLNAGPGSIGGAFVHQRHAQTDRPRFAGWWGQQQATRFQMGDRFEATPGAEGWQL
SNPPIFAMAPLLASLELFQAVGMTALREKSIRLTGYLEWLIDTELADVVQVLTPRDPRRR
GAQLSLRVLGGRDQGRALFEHLSDGGIIGDWREPDVIRLSPVPLYNRYADCRAAVDAMAQ
WRAMRR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtatcgatccgaccccgcctgggccgccgcagccgacgcggcagacccgctg
cgacactgtcgcgacgcctttctgatcccgccgcacggcgcgtccgacagtcattatttc
tgcggccattcgctgggcctgcagccacgccagaccgctgccgagctgcagcaggaactg
caggactgggccagcctcggcgtcgaaggccatttcaagggccggcgcccctggctggac
tatcaccgccgcctgacccgaccgctggccggactggtcggtgcccgcgacgacgaagtg
gtggcgatgaacagcctcagcgtcaacctgcacctgctgatggtgagcttctaccggccg
acggcggaacgccctgcgatcctgatcgaagccggcgccttcccttcggaccgctacgcg
gtggaatcgcagatccgctttcatggactggatccggccaaggccttgatcgagctgcac
cccgatcaggccgatggcagcttctccgaccaggccatttgcgaggcttttgccgaacac
ggtccgaaactggccttggccttgctgcccgccgtgcaataccggaccggccaggccttt
ccgctggccgatatcagtcgctgggcccatgcacagggctgtctggtcggctttgacctc
gcccatgcggtcggcaacctcgacctgcagctgcatgccagcgaggtcgacttcgcggtg
tggtgcagctacaaatatctgaatgccggccctggctcgatcggaggcgcctttgtccat
cagcgtcacgcccagacagaccggccccgttttgccggctggtggggccagcaacaggcc
actcgcttccagatgggtgaccgcttcgaagcgacacccggtgccgaaggctggcagctg
tccaaccctccgatcttcgcgatggcaccgctgctggcctcgcttgagctgttccaggca
gtaggcatgaccgctctgcgcgaaaaatcgatacgtctgacgggctatctggagtggctg
atcgataccgaactggccgacgtggtgcaggtcctcaccccccgcgacccgcgacgccgc
ggcgcgcagctgtccctgcgcgtgctgggcggccgcgatcagggccgggccctgttcgag
cacctgtccgatggcggcatcatcggcgactggcgcgaaccggatgtgatccggctctcg
cccgtcccgctgtacaaccgttatgccgactgccgcgcggccgtcgatgccatggcgcaa
tggcgggccatgcggcgctga

DBGET integrated database retrieval system