KEGG   Frateuria aurantia: Fraau_2467Help
Entry
Fraau_2467        CDS       T01773                                 

Definition
(GenBank) fatty acid desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
fau  Frateuria aurantia
Pathway
fau00591  Linoleic acid metabolism
fau01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    Fraau_2467
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fau01004]
    Fraau_2467
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     Fraau_2467
Lipid biosynthesis proteins [BR:fau01004]
 Desaturase
  Front-end
   Fraau_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AFC86830
UniProt: H8L6L4
LinkDB All DBs
Position
2636182..2637297
Genome map
AA seq 371 aa AA seqDB search
MSRTRNRPLSSDELKAFGDELDAIRARVTADIGLSDARYIRRIVAAVRWSGVAGRALLFL
GAFVHVVLVPAWITGVILLALSKILENMEVGHNVMHGQYDWMNDPRLNGRTYEWDIVATS
DNWRKTHNFRHHTYTNVRGMDDDIGYGLLRIFPEQRWRPFYLMQPAIAVVFMLLFEWGVA
IQDLRLGRWFAGKTSTAEIREAFRPVRRKMGRQLLKDYVVFPLLAGPYFLPVLLGNIVAN
VLRSIWTFVIIFCGHFTADAEVFPKQSISDESRGHWYLRQLRGSSNIAGGKLFNVLTGNL
SHQIEHHFYPDLPANRYAAIAVEVKQVCARYGQSYNTGSLPRQFGQVIWRILRHAFPSHP
ALQNEAKAGAI
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtacccgcaaccgccctctttcgtccgacgaactcaaggccttcggcgatgag
ctcgatgccatccgtgcccgagtgaccgccgacatcggtctgagtgatgctcgctatatc
cgccgcattgtcgccgcggtgcgctggtccggtgtcgccggacgcgcgctgctgtttctg
ggagcgttcgtgcacgtcgtactggtccccgcgtggatcactggcgtgattctgctcgcg
ttgtcgaagatcctcgagaacatggaggtcgggcacaacgtcatgcacggccagtacgac
tggatgaacgaccccaggctcaacgggcgcacgtacgaatgggacatcgtcgccaccagc
gacaactggcgcaagacacacaacttccggcaccacacctataccaacgtccgcggcatg
gatgacgatatcggttacggcctgctgcgcatctttcccgaacagcgctggcgcccgttc
tatctgatgcagccggccatcgccgtggtgttcatgctgcttttcgagtggggcgtggct
atccaggacctgcggctggggcgctggtttgccggcaagacatcgacggcggagatccgc
gaagccttccgcccggtccgccgcaagatgggacgccagctgctgaaagattacgtggtg
ttcccgctgctggccggcccgtacttcctgcccgtactgctgggcaatatagtggccaac
gtgctgcgcagcatctggaccttcgtgatcatcttctgcggacacttcaccgccgatgcc
gaggtattccctaagcaatcgatcagcgacgaatcacgcggccattggtatctgcgccag
ttgcgcggctcgtcgaatatcgcaggcggcaagttgttcaacgtgcttaccggcaatctc
agccaccagatcgaacatcacttctaccccgacctgcccgccaatcgctatgcggccatc
gctgtcgaggtaaagcaggtctgcgcgcgctatggccagtcctacaacaccggctcgctg
cccagacagttcggtcaggtgatctggcgcatcctgcgccatgccttcccaagccacccc
gccctgcagaacgaagccaaggcaggcgcgatctga

DBGET integrated database retrieval system