KEGG   Frateuria aurantia: Fraau_3217Help
Entry
Fraau_3217        CDS       T01773                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
fau  Frateuria aurantia
Brite
KEGG Orthology (KO) [BR:fau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Fraau_3217
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Fraau_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like NAD_binding_8 FAD_binding_3 DAO AlaDh_PNT_C K_oxygenase Thi4 FMO-like NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AFC87540
UniProt: H8L1D1
LinkDB All DBs
Position
complement(3506504..3508099)
Genome map
AA seq 531 aa AA seqDB search
MLDSTLKTQLKTYLEKVTQPIEIVASLDAAAKSVELRELLGEIAGLSEKITLREEIEAGA
PVPSFAINNPGQVSGVRFAGIPLGHEFTSLVLALLQVGGHPSRLGMDVIEQIRELPGPLS
FETYFSLSCQNCPDVVQALNLMSVLNPAISHTAIDGALFPEQVEARQIMSVPTVYLNGQV
FGQGRMGVEEIVSKLDSGADKRDAARLAAKDRFDMLMVGGGPAGASAAIYAARKGIRTGV
VAERFGGQVLDTMAIENFISVQETEGPKLGSALEEHVKSYEVDIMNLQRAVSLSRQGGEI
EVGLANGASLKARSVVISTGARWRQMNVPGEDQYRNKGVAYCPHCDGPLFRGKRVAVIGG
GNSGVEAAIDLAGIVAEVTLIEFGDQLRADAVLQKKLQSLPNVKVLMSAQTTEVIGDGSR
VTGLAWKDRGTGELHSLALEGIFVQIGLVPNTEWLQGVIELSPRGEIIVDDRGQTSMPGV
FAAGDATTVPFKQIVIAMGEGAKASLAAFDYLIRSSVASSQDTGPVSAQAA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgttggacagcactctcaaaacccagttgaagacctacctggaaaaggtcacgcagccg
atcgagatcgtcgcgtcccttgatgcagctgctaagtcggtcgagctgcgcgagctcctt
ggcgagatcgccggtctgagcgaaaagatcacgttgcgcgaggaaatcgaagccggtgcg
ccggtgccttccttcgcgatcaacaatcccggccaggtcagcggtgtccgcttcgccggg
atcccgctgggccatgaattcacctcactggtgctggcactgctgcaggtcggtggccat
ccgtccaggcttggcatggatgtcatcgagcagatcagggaactgcccggcccgctcagt
ttcgagacttatttttcgctgagctgccagaactgcccggatgtggtgcaggccctgaat
ctgatgtcggtgctcaatccggccatcagccataccgccattgacggcgcactgttcccg
gagcaggtcgaggcgcgccagatcatgtcggtacccacggtttatctgaacggccaggtc
ttcggacagggccggatgggggtcgaggagatcgtcagcaagctggacagtggcgcggac
aagcgcgatgccgcccggctggcggccaaggatcgctttgacatgctgatggtcggcggt
ggcccggccggtgcttccgccgccatctacgcggcccgcaagggcatccgtaccggtgtg
gtcgccgagcgtttcggtggccaggtactggataccatggcgatcgagaatttcatttcg
gtgcaggaaaccgaaggccccaagctcggcagcgcgctggaagagcacgtcaagagctat
gaggtggacatcatgaacctgcagcgggccgtttcgctcagccgccagggcggcgagatc
gaagtcggtctggccaacggcgccagcctgaaggcccgttcggtggtgatttccacgggt
gcccgctggcggcagatgaatgtgccgggcgaagatcagtaccgcaacaagggcgtggcc
tattgcccgcattgcgatggcccgctgttcaggggcaagcgagtggcggtgattggtggt
ggcaattcgggcgtcgaagcggccattgatcttgcgggcatcgtcgccgaggtgactctg
atcgagttcggtgaccagctgcgtgccgatgcggtattgcagaagaaactgcagagcctg
cccaacgtcaaggtcctgatgtcggcccagaccaccgaggtcatcggtgatggcagccgg
gtcaccggtctggcctggaaggatcgcggcactggcgaacttcactcgctggcgctggaa
ggcatcttcgtgcagatcgggctggtgccgaataccgagtggctgcagggcgtgatcgag
ctcagcccgcgcggcgagatcatcgttgatgatcggggccagacctcgatgccgggggtc
tttgccgccggcgatgccaccacggtgcctttcaagcagatcgtgattgccatgggtgag
ggtgccaaggcttcgctggctgccttcgactatctgatccgcagctcggtggcatcttcg
caagacacgggcccggtgtcggcgcaggcggcctga

DBGET integrated database retrieval system