KEGG   Flavobacteriaceae bacterium 3519-10: FIC_00604Help
Entry
FIC_00604         CDS       T00953                                 

Definition
(GenBank) Amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
fba  Flavobacteriaceae bacterium 3519-10
Brite
KEGG Orthology (KO) [BR:fba00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FIC_00604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C DUF1345 DUF5357
Motif
Other DBs
NCBI-ProteinID: ACU07059
UniProt: C6X3S1
LinkDB All DBs
Position
627000..628676
Genome map
AA seq 558 aa AA seqDB search
MSNLWRTKPLNQLLAEADETEHGLKKTLSSTSLIALGIGAIIGAGLFSITGMAAANYAGP
GIMISFIIAALGCAFAGLCYAEFASMIPVAGSAYTYSYATMGEFIAWIIGWDLVLEYAVG
AATVASSWSGYLGRFFYSFGVALPEQLMTTPFDITSTGASGLINLPAIFIVLIMSLVLIK
GTSESAWVNSAIVILKVGIVLLFIIVGFKYVKPENLTPLIPENTGKFGEYGWTGIIRAAA
VVFFAYIGFDAVSTAAQETKNPKKSMPIGIMGSLLICTVLYIIFAYVMVGVVHYKDFTAG
GGSDHLAPVAIAIDAMGEVVNGTMVPAYPWLNTTIILAILLGYASVILVMLMGQSRVFYA
MSKDGLLPKVFSEIHPKYRTPYKSNLFFLVFVSLFAAFIPGRVVGEMTSIGTLFAFILVC
VGVLVLRKTQPNAPRAFRTPLVPLIPVLGILVCFGMMAFLPLDTWIRLVCWMMIGLDLYL
YSGIKNSHLGKLNNTTNDPKNFTITAISGAVLTAILAVLAFLHHQNAETDDSGLIIFSVV
MAVIHAVLYGYYFFKYKK
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctctggagaacgaaacccctgaatcagctgttggcagaagccgacgaaact
gagcatggtcttaaaaaaactttatcttctacgtcgcttatcgcgctcggaataggagct
attattggcgccgggcttttctcgatcaccggaatggccgccgcaaactacgcgggtccc
ggaattatgatttcatttatcatcgcggcacttggctgtgcatttgcaggattgtgttat
gctgaatttgcttccatgatccctgtggccggcagtgcctatacttattcctacgctaca
atgggcgaatttatcgcctggattatcggttgggatttggttcttgaatatgcagtaggt
gcagcaactgtggcatcgagctggagtgggtatctcggtaggtttttctattcatttggg
gtggcactgcccgaacagctgatgactacgccgttcgacatcacctctacaggggcatcg
gggcttatcaatcttccggcaatctttatcgtactcatcatgtcattggtcctgatcaaa
gggaccagcgagtcggcctgggtaaacagcgcgattgttatcctgaaagtgggtatcgtt
cttctgtttatcattgtcggttttaaatatgttaaacctgaaaacttaacaccgctgatc
ccggaaaatacagggaagttcggtgagtatggctggacgggcatcatccgcgcggcggcg
gtcgtcttttttgcctacatcggcttcgatgcggtttctacggcagcgcaggaaaccaaa
aatccgaaaaaatccatgcctataggaattatgggttcacttctgatctgtaccgttctt
tacatcatcttcgcatacgtaatggtgggtgtggtgcattacaaagattttacagcaggt
ggaggttcagatcaccttgctcctgtagccattgcaattgatgcgatgggcgaagtggtg
aacggcacgatggttccggcctatccgtggctcaacactactattatccttgctatttta
ttaggatatgcctcagtaatcctcgtgatgctgatgggccagagccgtgttttctatgcg
atgagtaaggacgggcttttacctaaagtattcagcgaaattcatccaaaatatagaact
ccctataaatctaacctgtttttccttgtgttcgtaagtttatttgcggcattcataccg
ggaagagtagtgggtgaaatgacgagtatcggaacgcttttcgcctttatcctcgtgtgt
gtgggggtattggttctgagaaaaacgcagccgaatgcgccgcgtgctttcagaacgccg
cttgtgccgttaattccggtattgggaatattagtatgtttcggtatgatggcgtttctg
ccacttgatacgtggatccgattggtttgctggatgatgatcgggctcgatctgtatctg
tacagcgggatcaaaaactctcacctcgggaaattaaacaacaccaccaacgacccgaaa
aacttcaccattacggcgatttcaggagctgtacttactgccatcctggcggtacttgca
ttcctgcatcatcagaatgcggagactgacgacagcggactgattatcttctcggtggtc
atggcggttattcacgccgtgctgtacggttactatttctttaagtataaaaaatag

DBGET integrated database retrieval system