KEGG   Flavobacteriaceae bacterium 3519-10: FIC_00780Help
Entry
FIC_00780         CDS       T00953                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba00020  Citrate cycle (TCA cycle)
fba00310  Lysine degradation
fba00380  Tryptophan metabolism
fba01100  Metabolic pathways
fba01110  Biosynthesis of secondary metabolites
fba01120  Microbial metabolism in diverse environments
fba01130  Biosynthesis of antibiotics
fba01200  Carbon metabolism
Module
fba_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fba_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fba00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FIC_00780
  Amino acid metabolism
   00310 Lysine degradation
    FIC_00780
   00380 Tryptophan metabolism
    FIC_00780
Enzymes [BR:fba01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FIC_00780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ACU07233
UniProt: C6X495
LinkDB All DBs
Position
811101..813899
Genome map
AA seq 932 aa AA seqDB search
MDKFSFLNAAHSQLIEDLYQQYLKYPDSLEPSWKAFFQGFDFALETYEDEIAGSSQAPSV
VRAATQSAAKGEIPEDIQKEFKVLNLIEGYRQRGHLFTNTNPVRARRNYEPTLAIENFGL
SQSDLQTKFNSATETGLSAAASLQDIIKHLEKIYCESVGVEYMHINNVEEKKFIRKWLQV
NENQPQLTASEKTDILQKLNQAVAFESYLHTKFVGQKRFSLEGGESLIPALDQLITRSSQ
LGVDEVVLGMAHRGRLNVLTNIFGKSYKQIFSEFEGKEFEEDVFSGDVKYHLGSSKKIKT
ASGEEVAINLTPNPSHLETVAALVEGICRAKVDNKYKDYKKVLPIVIHGDGAIAGQGIVY
EIAQMMTLEGYKTGGTIHIVINNQVSFTTNYLDARSSTYCTDIAKVTESPVMHVNADDVE
AVVYAMKFAADFRANFGKDVYIDLLGYRKYGHNEGDEPRFTQPNLYKLISKHPNPREIYK
EQLIKEGIVSDEILKKMETEFKTLLDADFDASKEIERNTMNIFMEDDWKDYTMGARGVMQ
NEVETGFDLDKLKELALKMSTLPADKKFINKTTRLFDNRKKMIEGNSLDWALGEWLAYAT
LLTEGNNVRISGEDVERGTFSHRHAVVKTEDTEEEYIPLRHISESRFDIFNSHLSEYGVL
GFDYGYAMASPNTLTIWEAQFGDFVNGAQIIVDQYLAAAEEKWKIQNGLVMLLPHGYEGQ
GAEHSSARLERFLGLCANENMAVANVTTPANYFHLLRRQQKWAFRKPLVVMTPKSLLRHP
KVVSPLEDFANGSFQPVIDDQTAVADNVDKLVLCSGKIYYELLAKQEERKCDNIALVRIE
QLYPLHKESIDAVLSKYGSRKKIIWAQEEPENMGAWAYILRNLRDTGIQVIAPVSSGSPA
PGSHKMFERNQNNVLNQVFDCNDEPATRPVTA
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattttcatttttgaatgctgcgcattcgcagctgatagaagacttataccaa
caatatttaaaatatcccgactccctagaaccttcctggaaagcgtttttccagggattt
gattttgcgcttgagacctatgaagacgaaattgcaggttcttcacaggctccgtccgtt
gtgcgggctgccactcaatctgcagctaaaggcgaaattccggaggacatccagaaggaa
tttaaagtcctgaatttaattgaaggttaccgccagcgcgggcatctttttacaaatacc
aacccggtacgtgctcgtagaaattatgagccgacgctcgcaatcgaaaatttcgggctt
tctcagtcggatttgcagacgaaatttaattctgcaacggaaaccggattaagtgctgct
gcatcacttcaggacatcatcaagcatctcgaaaaaatttattgcgaatctgtgggtgtg
gaatacatgcacatcaataacgtagaagagaaaaagtttatccgcaagtggcttcaggta
aatgaaaaccagccgcaactcaccgcgtctgaaaagaccgatattttacagaagcttaat
caggctgtagctttcgagagttatctgcataccaaatttgttgggcagaaaagattttca
cttgaaggtggcgaatctttaatcccagcgctcgatcagttaattacacgctcatcgcaa
ttgggcgtagatgaggttgtattggggatggcacaccgaggccgtctgaacgtattgacc
aatattttcggtaaatcctacaaacagatattttctgaatttgagggaaaagagtttgaa
gaagatgtattctcaggagatgtgaaatatcaccttggttcatcgaagaaaattaaaacg
gcttcaggcgaagaagtggcgataaaccttacgccgaatccttcgcatcttgaaactgtt
gccgcattggtggaaggcatttgccgtgcaaaagtagacaacaaatataaagactataaa
aaagtacttccaattgtaattcacggcgacggtgcaattgccggacagggaattgtgtac
gaaatcgcgcagatgatgacgctcgaagggtataaaactggcggaacaatccatatcgta
attaacaaccaggtttcattcacaactaattatcttgatgcgagatcatcaacttactgt
accgatattgcaaaagttaccgaatctccggtgatgcacgtaaacgcggacgatgttgaa
gccgttgtgtatgcgatgaagttcgcagcagatttccgtgcgaattttggtaaagacgtg
tacattgatcttttgggatatagaaagtatggccataacgaaggtgatgagccccgtttt
acacaaccaaacctgtataaactgatttcgaagcatccgaatccaagagaaatttataaa
gaacaactgatcaaagaaggaattgtttcagatgaaatcttaaaaaagatggaaactgaa
tttaaaacacttcttgacgcagatttcgacgcttccaaagagatcgaacgcaacaccatg
aacatcttcatggaggacgactggaaagattacacgatgggagcccgtggcgtaatgcag
aatgaagttgaaacaggcttcgatcttgataaactgaaggagttggctttaaaaatgtcg
actttacctgctgataaaaaattcatcaacaaaactacacgactgttcgacaaccgtaag
aaaatgatcgaaggcaactctctcgattgggctttgggcgaatggttggcgtatgctact
ttgcttaccgaaggcaacaacgtacgtatttcgggtgaagatgtagagcgcggaactttc
tctcaccgtcatgcagttgtgaaaactgaagataccgaagaagaatatatcccactaaga
catatctcagaaagccgttttgatattttcaattctcacctttccgagtacggcgtactt
ggatttgattatggctatgcaatggcctcacctaacacacttaccatttgggaagcacag
ttcggcgattttgtaaacggcgcacaaattattgtagaccaatatttagcggccgccgag
gaaaaatggaagatacagaatggtctggtcatgttgttacctcacggatacgaaggacag
ggtgcggagcattcttcagcaagacttgaaagattccttggcctgtgtgcgaacgaaaat
atggccgtagcaaacgttactacgcctgcaaactacttccaccttctcagaagacagcaa
aaatgggcgttcagaaaaccgctcgtggtgatgacaccaaaatcgctgttgcgtcatccg
aaagtggtttctccgcttgaagattttgcaaacggaagctttcagccagtgatagatgat
cagactgctgttgcggataatgtagataaacttgttctttgctccggtaaaatttattat
gaattgctggcaaaacaggaagaacgcaaatgcgataacatcgcgttggtacgtatcgaa
cagctgtatccgctgcataaagaatctattgatgccgttctgtccaaatatggcagcaga
aaaaagatcatctgggcacaggaagaacccgaaaatatgggtgcatgggcatatatcctg
cgcaacttacgcgataccggaattcaggtaatcgctcccgtatcaagtggatcaccggcg
ccgggaagccataaaatgttcgaacgaaaccaaaacaacgtactgaaccaggttttcgac
tgtaacgacgaacccgctacaagacctgttaccgcataa

DBGET integrated database retrieval system