KEGG   Flavobacteriaceae bacterium 3519-10: FIC_00895Help
Entry
FIC_00895         CDS       T00953                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fba00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FIC_00895
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fba03400]
    FIC_00895
Enzymes [BR:fba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FIC_00895
DNA repair and recombination proteins [BR:fba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FIC_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ACU07347
UniProt: C6X4K9
LinkDB All DBs
Position
926922..929612
Genome map
AA seq 896 aa AA seqDB search
MALEQYRNKRSEHKTPEPFGGKPSGKELKFVVQKHHASHLHYDFRLEMDGVLKSWAVPKG
PSLDPKVKRLAMMVEDHPYDYRNFEGSIPKGQYGGGTVIVWDEGTYEHDDASESVKKQEK
SLLADLKSGKLKFRLNGHKLKGEFALVKAYGRGEDSWLLMKLNDEFATAEDITLMDESVI
SNKTIDEMAEAPDKIYGQKSEKKKPAISKKATPKKSAKTKNAQIAEVIEEPTADISKILK
AAPQQKFYTSVEPMLATLVDQPFDSDEWIYEVKWDGYRAVAFMNEGEVEMKSRNDKSFNE
KFYPIYDELKKMNINAILDGEVVVLGTEGKANFGALQNWRSESDGDLVFYVFDLLWYEGK
DLKSLPLTTRKQILDEILPKSETVMKSEVFETSGIEFLEAAKKMDLEGIMAKRKDSRYHI
KNRTKDWLKIKANKRQEVVIGGYTLNDDSRKLFSSLLVGVYEGTKLVYTGKVGTGFNAKC
QREMMDMFAPLVTDKPPFDKEPDVNKPSRFRPDPPHATVTWLKPKLLCEVSFTELTTDGI
MRHPSFQGMRTDKSAKTVTLETEQPVAEIVKDDTMIISTRKKADRKTLLNPKDKSQVKKV
NGHELKFTNLDKIFWPDEKLTKRDLINYYYQVAPYILPYLKGRPQSMNRYPDGIEGESFY
FKDVTGKAPDWAETLGYVSESDGRERRYLVGKDEATLLFMANLGCIEMNPWNSTIKKPDH
PTFCIIDLDPDENTFDQVIETAQVTKQLLDSMGAPSYCKTSGSTGLHIYIPLGNKYTYEQ
SKEFARALVTLVHQELPEITSIERIIKKRKGKMYLDFLQNRPHATIAAAYSVRPKPGATV
SMPLHWDEVKKGLKMKDFTMQNALERIKSEGDIFKPVLGKGIDLEKVLRKFEESRK
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atggctctggaacagtaccgcaataaaagatctgaacataaaacacccgaaccatttggc
ggcaaaccttcaggaaaggaacttaaatttgtcgtacagaagcatcacgcttcacatctt
cattacgatttccggctcgaaatggatggggtgctcaaaagttgggcggtaccgaaaggg
ccgtcgctcgatccgaaggtcaaacgtctggcgatgatggttgaggatcatccttatgat
taccgcaacttcgagggctcgattccgaagggacagtatggaggtggaaccgtaattgtg
tgggatgaaggcacctacgaacatgacgatgcatccgaaagtgttaagaaacaggaaaaa
tcgctgcttgcagatttgaagtcgggtaaacttaagttccggctcaacgggcataagctc
aaaggcgaatttgcacttgtaaaagcctacggacgcggagaagatagctggctgctcatg
aaacttaatgacgaatttgcaactgctgaagacattactttaatggatgagtccgttatt
tcaaataaaacaatcgacgaaatggccgaagcaccggataaaatttatggccagaaatcc
gagaaaaaaaaacctgcaatttcaaaaaaagctactccgaaaaagtccgcgaaaacaaag
aatgcacaaatcgcagaagtaatagaagaacccacggcagatatctccaaaattttaaag
gccgcacctcaacagaaattttacaccagcgttgaacctatgctcgcaaccctcgttgat
cagcctttcgacagtgacgaatggatttacgaggtgaaatgggacggttaccgcgctgta
gcgttcatgaatgaaggcgaagtggaaatgaaatcgcgcaacgataagagtttcaatgaa
aagttctatccgatttacgacgagcttaaaaagatgaatattaacgcaatcctcgatggt
gaagtagtggtactgggaactgagggcaaggctaactttggcgcgttacaaaactggcgc
agcgaatcggatggcgacctcgttttttatgtgttcgatctcctgtggtatgaaggcaaa
gatctgaagtcactaccactcacaacccgcaagcagattctggatgaaattctgcctaaa
agtgaaaccgtaatgaaaagtgaagttttcgaaacttcaggcattgagtttctcgaagcc
gccaaaaagatggatctcgaaggcatcatggccaaacgaaaagacagtcgctaccacata
aaaaaccgcacaaaagactggctcaagattaaagccaacaaacgccaggaagtcgtgatc
ggcggttatacgctcaacgatgattcacggaaactcttcagcagccttctggtaggcgtt
tacgagggtacgaaattagtttatacgggcaaagttgggacaggttttaatgcaaaatgc
cagcgcgagatgatggatatgttcgccccgcttgttactgataaacctccgttcgataaa
gaacccgacgtcaacaaaccttcacgtttccgtccggatccacctcacgccacagtcaca
tggcttaaacccaaacttctttgcgaagtgagttttactgaattgacgaccgacggcatc
atgcggcatccgtcattccagggaatgcgcaccgataaaagcgccaaaaccgtaacactc
gagaccgagcagcccgttgcagaaattgtaaaagacgacaccatgattatatccacccga
aaaaaagccgaccgtaagacgcttcttaatcccaaggataaaagccaggtaaaaaaagtg
aatgggcatgagcttaaattcaccaacctcgacaagattttctggcccgacgaaaagctc
acaaagcgcgacctcatcaactattattatcaggttgcgccttatattttaccttacctc
aaaggccgtccacagagtatgaaccggtatccggacggtattgaaggtgaaagtttctat
tttaaagatgttacaggcaaggcgccggactgggcagaaacgcttggctatgtgagtgaa
tcagacggtcgcgaaagacgctatctggtcggcaaagatgaagcaacgttactctttatg
gccaacctaggctgcattgaaatgaatccgtggaacagcaccattaaaaaacccgatcat
ccgacattctgcattatcgatctcgatcctgacgagaatactttcgatcaggtcatcgaa
actgctcaggttacaaaacagttactcgacagcatgggagcgccttcctactgcaagacg
agcggctccaccgggctgcatatttatattccgctcgggaacaaatatacctacgagcag
tcgaaagaatttgcaagggcgttggtaacacttgtccatcaggaactgcctgaaattaca
agtatcgagcgcatcataaagaagcgtaaaggcaagatgtatcttgatttcctccagaac
cgtccgcacgccaccattgccgctgcctattcggtaaggcctaaaccgggcgctacggta
tcgatgccgctgcattgggatgaggtgaaaaaaggtcttaaaatgaaagattttacgatg
cagaatgcactcgaacgcatcaaaagtgaaggcgatatcttcaaaccggttctcggcaaa
ggcattgatctcgaaaaagtgctgcgtaaatttgaagagagcagaaaatga

DBGET integrated database retrieval system