KEGG   Flavobacteriaceae bacterium 3519-10: FIC_01805Help
Entry
FIC_01805         CDS       T00953                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Pathway
fba03030  DNA replication
fba03410  Base excision repair
fba03420  Nucleotide excision repair
fba03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fba00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FIC_01805
   03410 Base excision repair
    FIC_01805
   03420 Nucleotide excision repair
    FIC_01805
   03430 Mismatch repair
    FIC_01805
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fba03032]
    FIC_01805
   03400 DNA repair and recombination proteins [BR:fba03400]
    FIC_01805
Enzymes [BR:fba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FIC_01805
    6.5.1.6  DNA ligase (ATP or NAD+)
     FIC_01805
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     FIC_01805
DNA replication proteins [BR:fba03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    FIC_01805
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     FIC_01805
DNA repair and recombination proteins [BR:fba03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     FIC_01805
   NER (nucleotide excision repair)
    Other NER factors
     FIC_01805
   MMR (mismatch exicision repair)
    Other MMR factors
     FIC_01805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ACU08248
UniProt: C6X1D5
LinkDB All DBs
Position
complement(1939961..1941541)
Genome map
AA seq 526 aa AA seqDB search
MKHFAELISSLESSNKTTAKVDAMVHYLRTAPENDKLWFLALFTGKRPKRPVNTNLLRQW
ALEIIQLPEWLFLESYSSVGDLGETISLILPPPQNDISKSLSQWMDELGDLAHKTEAEKK
AYVTESWNGLDYTERFIFNKLIGGSFRIGVSKKLLISALSKYSEIDSSQLMHSIMGKWDI
NEINFEDLIAGININPDNSKPYPFCLAYPLEKETDELGDPAEWQAEYKWDGIRGQLIRRN
DEVFIWSRGEELVTPQFPEIVSALEKMTGNFVIDGEILAVTEKGVLNFNELQKRLNRKTI
SAKMLKEIPVKVFAYDILERDDEDLRGKPLTYRRKILEELIHSQAPENITLSDIVPFQKW
EDLVEVRDNSRLNNSEGLMLKHKESLYHSGRKKGDWWKWKVDPLTIDAVLIYAQKGSGRR
SGYYTDYTFAVKKEDQLVTVAKAYSGLTDKEIMEVSRFVTKNSLEKFGPVRTVKPELVFE
IAFEGIGLSNRHKSGVALRFPRILRWRRDKKADEIDDIEEVKKLIR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattttgcagaactcatatcatccctcgaaagcagtaataaaaccaccgctaaa
gttgatgcgatggtgcattatctgcgcaccgctccggagaatgacaagctgtggtttctc
gcacttttcacaggtaaacggccgaaacgtccagtaaataccaatttgctgagacaatgg
gcgctcgagattattcagctgcctgaatggctttttctagaaagttattcctcagtcggc
gatctcggcgaaaccatttcactcatacttccgccgcctcaaaacgacatcagcaaatcg
ctgtcgcagtggatggatgaactgggtgatcttgcccataaaaccgaagcggaaaagaaa
gcctacgtcaccgaatcctggaacggcctcgattacaccgaacggtttatcttcaataaa
ctcattggcggaagtttccgcatcggggtttcaaaaaaacttctgatcagtgcgctctca
aaatactccgaaatagattccagccagctgatgcacagcattatgggcaaatgggacatc
aatgaaattaattttgaagacttaatcgccggcatcaacatcaatcctgataattccaaa
ccttatccgttctgccttgcatatccgctcgaaaaggaaaccgatgagctcggcgacccc
gcagaatggcaggctgaatataaatgggacggaatccgcgggcaactgatacgtcgcaac
gacgaagtttttatctggtcgcgcggtgaggaacttgttactccgcagttccctgaaatt
gtttcagctcttgaaaaaatgacgggcaacttcgttatcgacggcgaaattctggccgtg
acggagaaaggcgtacttaatttcaatgaactgcaaaagcggctcaaccgtaagaccatt
agtgcaaaaatgctgaaggaaattccggtaaaagtttttgcctacgatattcttgagcgc
gatgatgaggatttacgaggtaaaccgctgacataccgcagaaagattctcgaagagctg
atccacagccaggcacccgaaaacattacactttccgacatcgtgccgtttcaaaagtgg
gaagacctcgtggaagtacgcgataattcgaggttgaacaacagcgaaggcctgatgctt
aaacataaagaatctctgtatcattcaggccgtaaaaaaggcgactggtggaagtggaaa
gttgatccacttaccatcgacgcggtgctgatctatgcccaaaaaggcagtggacgacgc
agcggctattacaccgattatacttttgcggtgaaaaaagaagaccagctggttaccgtt
gccaaagcctattcgggcctaaccgacaaagaaataatggaagtcagccgttttgtaacc
aaaaattcactcgagaagttcgggcccgtgcgcactgtgaaacctgagcttgtattcgaa
atcgcgtttgaaggaattggtctcagcaacaggcataaaagtggcgtcgcattgcgtttt
ccgcgaattctgcggtggcgtcgcgataaaaaagctgatgaaatcgatgatattgaagaa
gtgaaaaaactaatccgctga

DBGET integrated database retrieval system