KEGG   Flavobacteriaceae bacterium 3519-10: FIC_02556Help
Entry
FIC_02556         CDS       T00953                                 

Definition
(GenBank) superoxide dismutase, copper/zinc binding
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fba  Flavobacteriaceae bacterium 3519-10
Brite
Enzymes [BR:fba01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FIC_02556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-ProteinID: ACU08986
UniProt: C6X3H3
LinkDB All DBs
Position
complement(2739795..2740298)
Genome map
AA seq 167 aa AA seqDB search
MKIATISTLLFGSALALSCGTTKNLVIEPKSGTDTQGTAKFTQQGKNVELDLNVYKLTPG
AHAVHIHEKGDCSAADASSAGGHWNPTTESHGKWGHDQHHKGDIGNLNANQQGTARIVFK
TDQWCLGCGDETKNIVGKSLVIHAAEDDFKTQPTGNAGGRVGCIEIK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcgcaactatttctactttgcttttcggatcagcactcgcactttcatgcgga
acgacgaaaaatttagttatcgaacctaaaagtggcactgatacgcagggaactgccaaa
tttacccaacagggcaaaaatgttgaactcgaccttaatgtttataaactgacgccagga
gcacatgcggttcatatccacgaaaaaggagactgttctgcagctgacgccagttccgcg
ggcggccattggaaccctacgaccgaatcccacggtaaatggggccacgatcagcatcat
aaaggagatatcggaaatctgaatgcgaatcagcagggaacagccagaattgtatttaaa
acagaccaatggtgccttggttgtggcgacgaaaccaaaaatatcgtcggaaaatcgctc
gtgatccacgcggctgaagacgatttcaaaacccagccaacgggaaatgcaggcggcaga
gtaggttgtattgaaattaaatag

DBGET integrated database retrieval system