KEGG   Maribacter sp. HTCC2170: FB2170_06340Help
Entry
FB2170_06340      CDS       T01306                                 

Definition
(GenBank) putative thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00240  Pyrimidine metabolism
fbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    FB2170_06340
Enzymes [BR:fbc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     FB2170_06340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: EAR02885
UniProt: A4APG3
LinkDB All DBs
Position
complement(1704418..1705062)
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPMVDKRYHEEM
VVSHDANEIRSTPVPAAANIRILADTCDVIGIDEAQFFDDEIVTVCNDLANRGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKAHNDDLVLLGETGEYEP
LSRAAYYKAMLKERVKEIDVDVEEISKAKKDVNG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaataccgttaatcataaagaacaattcggctggatagaagttatctgc
ggctcaatgttttctggtaagaccgaggaattgattcggagattaaaacgtgcccaattt
gctaaacaaaaggtcgagatctttaagcccatggttgataaaaggtaccatgaagaaatg
gtggtttcccatgatgccaatgaaattaggtccactcccgtacctgctgcagcgaatatt
cgcattttggccgatacttgtgatgtgattggcattgatgaagcgcagttttttgatgat
gaaatagtgacagtttgcaatgacctagcaaatagaggggttcgagtaatcgttgcaggc
ctggacatggattttaaaggaaatccctttggtcctatgcctgccttaatggctactgca
gaatatgtaacgaaagtgcatgccgtatgtacacgcactggaaatttggccaattatagt
tttagaaaagcccataatgatgatctggtgcttttgggtgaaactggagaatatgaacct
ttgagcagagcggcgtattacaaggctatgcttaaagaacgggttaaggaaattgatgta
gatgttgaagaaatttcaaaagctaaaaaagacgtcaatggctaa

DBGET integrated database retrieval system