KEGG   Maribacter sp. HTCC2170: FB2170_16331Help
Entry
FB2170_16331      CDS       T01306                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00620  Pyruvate metabolism
fbc00680  Methane metabolism
fbc01100  Metabolic pathways
fbc01120  Microbial metabolism in diverse environments
fbc01200  Carbon metabolism
Module
fbc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FB2170_16331
  09102 Energy metabolism
   00680 Methane metabolism
    FB2170_16331
Enzymes [BR:fbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FB2170_16331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 DUF1093
Motif
Other DBs
NCBI-ProteinID: EAR00669
UniProt: A4AT99
LinkDB All DBs
Position
complement(53167..55710)
Genome map
AA seq 847 aa AA seqDB search
MHKTERLEEFKKSVNNKFNVYNSLFLNLPYRNIENVGMVVPLLLHQSVKGLKSGLNPQDI
LESFFQNYVNIENEKDRIDFMFRIIQYVERQVVLYDSVEDAAFPKLQEHSESLSIKDYFQ
LVNKTKSWDKVAEKLSSFSARIVLTAHPTQFYTPAVLDIMSDLRELIEENKIDDIDITLQ
QLGLTSLMNSKKPTPLDEAKNIIYILRHVYYDAMGDLYSYIKENIDDEDFQNHNIMKLGF
WPGGDRDGNPFVTADITRNVSDELRISLMKCYYNDLKTLQKKLTFKELQVHVRELRDKFY
AAMFNPETIVKYENIIETLSNIRGLLIDDYHGLYLSELDHFIDKVKIFKTHFATLDIRQD
HSMHIRVVQEILVKNEIIIADISELSEEDLVKVLINKDLKVNSNDYEGTIKDTLVNISQL
AAIQEKNGEEGCNRYIISNSEDIFSVLFVFGLFRWCGWKTNKITFDIIPLFETMKGMDNA
EATMQYLYDLPIYREHLERRGDKQTMMLGFSDGTKDGGYLKANWSILKTKEVLSKVSKKQ
HIKALFFDGRGGPPARGGGKTHRFYAAQTKDIANNEIQLTIQGQTITSTYGTKEQFMHNS
EQLLTAGLSNNLFGKENVISKEYRKLLEELSELSFNKYDALKKHEMFIPYLENRSTLKYY
QKANIGSRPGKRGNKKQLELTDLRAISFVGSWSQLKQNVPGYFGIGTAIKSLKETGKLRQ
LKKMYKEVPFFKALMLNSMMSLTKCYFELTSYMKEDQKYGEFWQILHEEYQLSIDMLLQI
SGSNILMENEAISRESIEIRENIVLPLLVIQQYALQKIGQSTEYKELYEKIVTRSLYGNI
NASRNSA
NT seq 2544 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaactgaaagattagaggaattcaagaaatcggttaacaacaaattcaatgtt
tacaatagcctgtttttgaacctgccatatcgcaatatagaaaacgtaggaatggttgtg
ccattgcttttgcatcaatctgtgaaaggactcaaatcaggattgaatccgcaagatatt
ttggaatctttctttcagaactatgtgaatatagaaaatgaaaaggatcgtatagatttt
atgtttcgtataattcaatatgtagaacgtcaagttgttttatatgatagtgttgaggat
gcggcatttccaaagctacaggaacatagtgaatcactatcaatcaaagattattttcaa
ctagtgaataagactaaaagttgggataaagttgctgaaaaattatcttcatttagtgca
agaatcgtgcttacagctcatccaacgcagttctatacccctgctgttttggatataatg
agtgatttacgtgagctaatcgaagaaaataaaattgatgatatagatatcacgctacag
caattgggactaacatcattgatgaacagtaaaaagccaacacctcttgatgaggccaag
aatatcatctacattttaagacatgtttattacgatgccatgggtgacctatattcttac
attaaagagaacattgatgatgaggattttcagaaccataatatcatgaagcttggtttt
tggccaggtggtgatcgagacgggaacccttttgttactgcagatattacgagaaatgtt
tctgatgaacttcgtattagtctaatgaagtgctactacaacgatctcaaaacgcttcaa
aagaaattgactttcaaggaactccaggtacatgtaagggaattaagggataaattctat
gctgctatgttcaatcctgaaaccatagttaaatatgaaaatatcattgaaaccctttcc
aatattagagggcttttaatcgatgattaccacggactttatttgagcgaattagatcat
tttattgataaagttaaaattttcaagacccactttgccacattggatattcgccaagat
catagtatgcatataagggttgtacaggagatattggtgaagaacgaaataataatagca
gatataagcgaactaagcgaagaagatttggtcaaagtattaattaacaaagacctgaaa
gtaaattccaatgattatgagggcacaataaaagatacccttgtgaatatttcgcagctg
gccgcaatacaagaaaagaatggcgaagaaggttgtaacagatatattatcagtaattct
gaggatattttctctgtactttttgtttttggtctatttagatggtgtggttggaaaacc
aacaaaataacatttgatattataccgctttttgaaaccatgaaggggatggacaatgca
gaggctaccatgcaatatttgtatgatttgcctatttatagagagcatcttgaaaggcgg
ggtgataaacagactatgatgttgggcttttctgatggtaccaaagatggtggatattta
aaggcaaactggtctatcttgaaaacaaaagaagtcctttcaaaagtgtctaaaaaacaa
catataaaagctttgttctttgatggccgcggcggaccaccagctcgtggaggtggtaaa
acacatagattttatgctgcgcaaactaaggacattgccaataacgaaattcagttaaca
attcaaggccaaacaattaccagtacctacggtactaaagaacagttcatgcataacagc
gaacaattgttaacagcagggttatccaacaatctttttgggaaggaaaatgtaatctct
aaagagtatagaaagttacttgaggaattatcagaattgagttttaacaaatatgatgca
ttaaaaaaacatgaaatgtttattccatatctggaaaaccgaagtacacttaaatattac
caaaaggccaatataggcagtagacctggaaaacgaggtaataaaaagcagttggaatta
actgatctaagagctatttcctttgtggggtcgtggagtcaattaaaacaaaacgtacct
ggttattttggaattggtacagccattaagtctttaaaagaaacaggaaagttacgccag
ttgaaaaaaatgtataaagaagttccattctttaaggctttgatgctcaatagtatgatg
tctttgaccaagtgttattttgagctaacaagttatatgaaggaagaccagaagtatggt
gaattttggcaaattcttcacgaggaatatcagttgtctattgatatgttattacagatt
tctggttcgaatatattgatggaaaatgaggcgatttctagagagtctattgagattcgt
gagaacatagtattgcccttattagtaattcaacagtatgccttacagaaaataggacaa
tcaacagaatacaaagaattgtatgaaaaaatagtaacacggtcactttatggtaacatt
aacgcaagtaggaattcggcttag

DBGET integrated database retrieval system