KEGG   Maribacter sp. HTCC2170: FB2170_16566Help
Entry
FB2170_16566      CDS       T01306                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fbc  Maribacter sp. HTCC2170
Pathway
fbc00380  Tryptophan metabolism
fbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    FB2170_16566
Enzymes [BR:fbc01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     FB2170_16566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: EAR00716
UniProt: A4ATE6
LinkDB All DBs
Position
complement(98370..99704)
Genome map
AA seq 444 aa AA seqDB search
MKKSTRESLTRNCTFEKKYTMQFENSLAFAQKLDTEDVLNDYKSQFHFPQINGKDVIYFT
GNSLGLQPKITKSYVDEVITDWKNLAVEGHFRSDKPWWDYHERLAKPLASVVGAKKEEVS
VMNTLSVNLHLLLVSFYRPTKKRFKILCEEKAFPSDQYILKSQVKFHGFDIEDAIVEVRK
REGEHFWRTEDILSKINEVGEEIALVLIGGVNYYNGQVFDMKAITKAGKTQGAFVGWDLA
HAVGNVELKLHEWDVDFASWCSYKYMNSGPGNASGIFVNKKYLHESDIPRFEGWWGTKKE
TRFLMKPEFEPIENADAWQISNPSVLSLAPYLASLQLFEEVGMNALIEKRDKIVSYLEFV
LNEIDGEVNGSFEIITPNERGCQLSVFLHGHGRPLFDFLMESGVITDWREPNVIRLAPAP
FYCSFEDMYRFGQILLKGIKSGIA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaatcgaccagagaaagtttaactcgaaattgtacttttgaaaaaaagtatact
atgcagttcgagaattcattggcttttgcccaaaaattggatactgaggatgttcttaat
gattataagagccaatttcattttccacaaataaacggcaaggacgttatttattttaca
ggaaattccttgggattgcaaccaaaaatcaccaaaagttatgttgacgaggtaatcact
gattggaagaatttggccgttgaaggtcattttcgttctgataaaccttggtgggattat
catgagcgtttagccaaacctttggcaagtgttgttggtgctaaaaaagaggaagtttca
gtaatgaacaccctgagtgtaaatcttcacttattactggtctcattttatagaccaaca
aaaaagagattcaagattttatgtgaggaaaaggcatttcccagcgatcaatatatactg
aaaagccaagtgaagtttcatggttttgatatcgaggatgccattgttgaggttagaaaa
cgagaaggggagcatttctggcgaaccgaagatattttgagtaaaatcaatgaagtgggc
gaggagattgccttggttttgataggtggtgtaaattattataatggccaggtatttgat
atgaaggcgattacaaaagcaggaaagacacaaggggcttttgttggttgggatttggct
catgctgtaggtaatgttgaactgaagcttcatgaatgggatgttgattttgcctcttgg
tgcagttataaatacatgaatagtggacctggtaatgcatcgggcatttttgtgaacaaa
aaatacttgcatgaaagtgatattcccaggtttgaaggatggtggggaactaaaaaagaa
acacgctttttaatgaagcctgaatttgaacctattgaaaacgctgatgcttggcaaata
agcaacccgtcagtattatctcttgcgccctatttggcctctttacagctttttgaggaa
gtggggatgaatgctttaattgagaaacgtgataaaatcgtctcttatctggagttcgtt
ttgaacgaaatagatggtgaagtaaacggttcttttgaaataatcacgccaaatgaaaga
ggttgtcaactgtctgtttttcttcatgggcacggtagaccattatttgattttttgatg
gagagcggtgtgataaccgattggcgggaaccaaatgtcataagattggcgccagcacct
ttttactgttcctttgaagatatgtatcgttttggtcaaatattgttaaaaggtattaaa
agcggtatcgcttaa

DBGET integrated database retrieval system