KEGG   Ferrimonas balearica: Fbal_0309Help
Entry
Fbal_0309         CDS       T01318                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00620  Pyruvate metabolism
fbl00680  Methane metabolism
fbl01100  Metabolic pathways
fbl01120  Microbial metabolism in diverse environments
fbl01200  Carbon metabolism
Module
fbl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fbal_0309
  09102 Energy metabolism
   00680 Methane metabolism
    Fbal_0309
Enzymes [BR:fbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Fbal_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADN74523
UniProt: E1SMG8
LinkDB All DBs
Position
complement(339539..342178)
Genome map
AA seq 879 aa AA seqDB search
MTDMYAPLKANVHLLGDILGETIEAEHGAAFLNLIEEVRQLSKASRQGDTEAQSKMLALL
SELPDEQLVPFASAFNQFLNLANIAEQFHTISRNCDELVCVPDPVDLLLGRLFNGKAQLK
PDQLIDELEKLEIDLVLTAHPTEVTRRTLISKYSALIECLSERENPQLSERETKRNQLRM
RQLVAQIWHTNEIRKQRPTPVDEARWGMATVETSLWHAVPEFLRQLNEQVEEHAGRQLPP
HVAPVRFSSWMGGDRDGNPFVTAKVSEEVLLRNRCTATRLYLEDINQLIGELSMTDCDQA
IRAMVGDHREPYRILLRQLREKLSDTQDYLMARLDGQQPKTNPSTLIWHKKDLLEPLELI
YQSLLDQGMRLIANGLLLDTLRRIHCFGLTLVRVDIRQSSDRHASAIAEITRYLGLGDYL
HWSEAEKQSFLLRELASRRPLLPHQWQASADTQEVLDTCRLIGQQSPEALGSYVISMASE
ASDVLAVALLLKECDCNFALPIVPLFETLSDLDNAPAVMRNLLQIDWYLGYCRGKQQVMI
GYSDSAKDAGVMAASWAQYRAQEALVSVCKDAGVALTLFHGRGGSIGRGGGPAHEAILSQ
PPGSVDSRLRVTEQGEMIRFKFGLPEVAVQSLALYTSAVLEATLLPPLAPKPEWRSLMDS
IADDSVRAYRQIVQDEPDFVPYFRAATPELELSALPLGSRPAKRRADGGVESLRAIPWIF
AWTQNRLMLPAWLGAGESLQNAIDQGHQETLQEMFLNWPLFRTRLSMLEMVYAKSEPNLS
RYYEQILVKPELHGLGEKLRQSLEIGVRSVLNLTQEQGLMDLTPWNKESVALRHPYIDPL
NFLQAELLRRCRQEPEDPALQQALMITIAGIAAGLRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatgtacgcccccctaaaggcgaacgtccacctgctgggcgatattttaggc
gagaccatcgaagctgagcatggcgccgcatttttgaatctgattgaagaggtgcggcag
ctgtccaaagcctctcgccagggggataccgaggcccagtccaagatgttggcactgctc
tccgagctgcctgacgaacagctggtgccctttgccagtgcctttaaccaattcctcaac
ctcgccaacatcgccgagcagttccacaccatctcccgcaactgcgacgagctggtgtgt
gtaccggacccggttgatctgctgctgggtcgcctgtttaacggcaaggcccagctgaaa
ccggaccagctgatcgacgagttggaaaaacttgagatcgacctggtgctgaccgctcac
cccacagaggtgacccgtcgcaccctgatcagcaaatactccgctctgatcgagtgtctg
agcgagcgcgagaacccgcagctcagtgaacgcgaaaccaagcgcaaccagctgcgcatg
cgccagctggttgcccagatctggcacaccaacgagatccgcaagcagcgccccactccg
gtggacgaagcgcgctggggcatggccaccgtcgaaaccagcctgtggcatgcggtaccg
gagttcctgcgccagttgaatgaacaagtcgaagagcacgccggccgccaactgccgccg
cacgtggcgccggttcgtttctccagctggatgggcggcgatcgggacggcaaccccttt
gtcaccgccaaggtcagcgaagaggtgctgctgcgtaaccgctgcactgcgacccgcctc
tacctggaagacatcaaccagctgattggcgagctgtcgatgaccgattgcgaccaggcc
atccgcgccatggtgggcgatcaccgcgaaccttaccgcatcctgttgcgtcagctgcgc
gagaagctgagcgacacccaggattacctgatggcccgtcttgatggccaacagccgaaa
accaaccccagcaccctgatctggcataagaaagacctgctcgaaccccttgagctgatc
taccaaagcctgctcgatcagggcatgcgcctgatcgccaatggcctgctgctggacacc
ctgcgccgcatccactgtttcggcctgaccctggtgcgcgtcgacatccgtcaaagctcc
gaccgccacgccagcgccattgctgagatcacccgttacctgggcctcggcgactacctg
cactggagcgaagcggagaagcaatcgttcctgctgcgggaactggccagccgccgtccg
ctgctgccgcaccagtggcaagcctctgccgatactcaggaggtactggatacctgccgc
ctgattggccagcaaagcccggaagcactgggttcctacgtcatctccatggccagcgag
gcctccgatgttctggccgtggcgctgctgctcaaagagtgtgactgcaattttgccctg
cccatcgtgccgctgttcgaaaccctcagcgacctcgacaacgccccggcggtgatgcgc
aacctgctgcagatcgactggtacctgggttactgccgcggcaaacagcaggtaatgatt
ggttactccgactccgctaaggacgccggggtaatggccgcctcctgggcccaataccgt
gctcaggaagcgctggtgagtgtctgcaaggatgcgggcgtagccctgaccctgttccat
ggccgtggtggctccatcggccgtggcggcggcccggctcacgaagcgatcctgtcccag
cccccgggctccgtagacagccgtctgcgggtcaccgaacagggtgagatgatccgcttt
aaattcggcttgccggaagtggcagtacagagtctggcgctctacacctcagcggtgctt
gaagcgaccctgctgccgccattggcgcccaaaccggagtggcgcagcctgatggacagc
atcgcggacgattccgtgcgcgcttaccgtcaaatcgtgcaggatgagccagacttcgtc
ccctacttccgcgccgcgacccctgagctggaactgtccgctctgccgctgggcagtcgc
ccggccaagcgccgtgctgacggcggcgttgagtccctgcgggccattccctggattttc
gcctggacccagaaccgactgatgctgcctgcttggctgggcgccggtgagagtctgcag
aacgccattgaccagggtcaccaggagacgctgcaggagatgttcctgaactggccgctg
ttccgcacccgtctgtcgatgctggagatggtgtacgccaagtccgaaccgaacctgtcc
cgttactacgagcagatcctggtgaagcctgagttgcatggtcttggtgagaagctgcgc
caaagcctcgaaatcggcgttcgcagtgtgctgaacctgactcaggagcagggccttatg
gacctgacgccctggaacaaagagtccgttgcgctgcgtcacccctacatcgatccgctc
aacttcctgcaggcggagctgctgcgtcgctgccgtcaggaaccggaagatccggctttg
cagcaggcgttgatgatcaccatcgccggcatcgctgctggcctgcgtaacacgggttaa

DBGET integrated database retrieval system