KEGG   Ferrimonas balearica: Fbal_0348Help
Entry
Fbal_0348         CDS       T01318                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00473  D-Alanine metabolism
fbl00550  Peptidoglycan biosynthesis
fbl01100  Metabolic pathways
fbl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Fbal_0348
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Fbal_0348
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Fbal_0348
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fbl01011]
    Fbal_0348
Enzymes [BR:fbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Fbal_0348
Peptidoglycan biosynthesis and degradation proteins [BR:fbl01011]
 Precursor biosynthesis
  Amino acid ligase
   Fbal_0348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: ADN74562
UniProt: E1SMK7
LinkDB All DBs
Position
382645..383565
Genome map
AA seq 306 aa AA seqDB search
MSEVVKQDKVAVLFGGTSAEREVSLRSGAAVLAGLQRGGVDAHPFDPAERSLDELKGFDR
AFIVLHGRGGEDGTVQGALELMKIPYTGSRVLGCAVAMDKVRTKWLWAGLGLPTADFEVV
DKESFSPNSAEDIMARLGSPVMVKPACEGSSIGMAKAEDAASLQKAIDTALQYDDTVLVE
AWVHGPEFTVSILGEEALPAIRMETPNVFYDYEAKYQSQTTQYHCPAGLSDDDEQALRAL
ALRAFKAVGASGWGRVDVMRDADGSWRLLEVNTVPGMTETSLVPKAANAVGVDFDTLVAR
ILAASY
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaggttgtgaagcaggacaaggtggcggtgctgtttggtggcaccagcgctgag
cgggaagtctctttgcgctccggtgctgcggtgctggccggattgcagcgtggcggcgtg
gatgcccacccgtttgacccggcagagcgctcgctggatgaacttaaaggcttcgatcgc
gcctttatcgtgctgcacggccgcggcggtgaagatggtaccgttcagggcgcgctggag
ctgatgaagatcccctacaccggctcccgggttctgggctgtgcagtggcgatggacaag
gtgcgcaccaagtggttgtgggctggccttggcttgccgactgcggattttgaagtcgtt
gataaagagtcgtttagtccgaacagtgctgaggatataatggcccgcttgggttcgccg
gtgatggtgaaacccgcctgtgaaggctcctccatcggcatggcaaaagctgaggatgcg
gcgtctttgcagaaggcgatcgacaccgctttgcagtacgacgataccgtgctggtggaa
gcctgggtccatggcccggagttcaccgtgtcgattcttggcgaagaggcgttgccggcg
atccggatggaaacccccaacgtgttttatgactacgaagccaagtatcagagccagacc
acccagtatcactgtccggcgggtctgagcgacgacgacgagcaggccctgcgggccttg
gcactgcgcgctttcaaggcggtgggtgccagtggctggggtcgggttgacgtgatgcgg
gatgcggatggcagctggcgtttgctggaggtcaacaccgtacccggcatgaccgaaacc
agcctggtgcccaaagcggccaacgctgtgggcgtggattttgacacactggtagcccga
attctggcggccagttactga

DBGET integrated database retrieval system