KEGG   Ferrimonas balearica: Fbal_0770Help
Entry
Fbal_0770         CDS       T01318                                 

Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
fbl  Ferrimonas balearica
Pathway
fbl03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Fbal_0770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:fbl03400]
    Fbal_0770
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Fbal_0770
DNA repair and recombination proteins [BR:fbl03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Fbal_0770
 Prokaryotic type
     Fbal_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADN74981
UniProt: E1SSE1
LinkDB All DBs
Position
835339..836025
Genome map
AA seq 228 aa AA seqDB search
MPVQNQWQPFLGGVKSEPYFQQMMAQIAEWRAQGQVIYPPQEQVFEAFRRTDFDQIKVVI
LGQDPYHGPNQAHGLCFSVQPGVKTPPSLVNIYKELANDIPGFQIPDHGYLAHWADQGVL
LLNTVLTVNAGQAHSHAALGWETFTDRVIELINAEREGVVFLLWGSHAQKKGRHIDTSKH
AVLKAPHPSPLSAHRGFLGCGHFSQTNAILREQGKTEIDWQPRLPEAG
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgttcagaaccagtggcaaccctttctcggcggcgtaaagtccgaaccctatttt
cagcagatgatggcgcagattgccgagtggcgtgcgcagggccaggtgatctatccgccc
caggagcaggtgtttgaggcgtttcgccgtaccgactttgaccagatcaaggtggtgatc
ctcggccaggacccttaccacggcccgaaccaggcccatggtctttgcttctccgtgcaa
ccgggggtgaaaaccccgccgtcactggtcaacatctataaggagctggccaacgacatt
ccggggtttcagatccccgaccacggctacctggcccactgggccgatcagggtgtgttg
ctgctcaatacggtgctgacggtcaacgccggccaggcccattcgcacgcagcactgggc
tgggaaacctttaccgaccgggtgattgagttgattaatgcggagcgggaaggggtggtg
ttcctgctgtggggcagccatgcccagaaaaaggggcggcatatcgacaccagcaagcat
gccgtgctgaaagccccccacccgtcaccgctgtcggcccaccggggtttcctcggttgt
gggcacttctcgcagaccaacgcgatcctgcgtgagcagggtaaaaccgagattgactgg
caaccccggttgccggaagcgggttga

DBGET integrated database retrieval system