KEGG   Ferrimonas balearica: Fbal_0963Help
Entry
Fbal_0963         CDS       T01318                                 

Definition
(GenBank) 3-hydroxyacyl-(acyl-carrier-protein) dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00061  Fatty acid biosynthesis
fbl00780  Biotin metabolism
fbl01100  Metabolic pathways
fbl01212  Fatty acid metabolism
Module
fbl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Fbal_0963
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Fbal_0963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fbl01004]
    Fbal_0963
Enzymes [BR:fbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Fbal_0963
Lipid biosynthesis proteins [BR:fbl01004]
 Fatty acid synthase
  Component type
   Fbal_0963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: ADN75172
UniProt: E1SU25
LinkDB All DBs
Position
1054791..1055240
Genome map
AA seq 149 aa AA seqDB search
MSEQLNTMDIQEILDYLPHRHPFVLVDRVLEIVPGERLVARKNVTFNEPFFPGHFPNMAI
MPGVLILEALAQASAILAFKTHGKQDNALYLFAGIDNARFKQPVVPGDSLTLEVEAIKER
RGIGFYSARALVDGKVVCSADLMCAKREI
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagagcaactgaacaccatggacatccaggagatcctggattacctgccccaccgc
caccctttcgtcctggtggatcgcgtgctggagatcgtcccgggcgagcgcctggtggcg
cgcaagaacgtcacctttaacgagccctttttcccgggtcacttccccaatatggccatc
atgccgggggtactgattctggaagcgctggctcaggcctccgccatcctggcgttcaaa
acccatggtaaacaggacaacgcgctgtacctgttcgccggcatcgacaacgcccgcttt
aagcagccggtcgtgccgggcgacagcctgaccctggaagtggaagccatcaaagaacgt
cgtggcatcggcttctacagcgcccgtgcgctggttgatggcaaggtggtgtgcagcgcc
gacctgatgtgtgccaaacgcgagatttaa

DBGET integrated database retrieval system