KEGG   Ferrimonas balearica: Fbal_1737Help
Entry
Fbal_1737         CDS       T01318                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fbl  Ferrimonas balearica
Brite
Enzymes [BR:fbl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Fbal_1737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADN75941
UniProt: E1SRJ0
LinkDB All DBs
Position
complement(1934246..1934827)
Genome map
AA seq 193 aa AA seqDB search
MAFELPALPYAKDALEPHISAETLEFHHGKHHATYVTKLNGLVEGTELAGKSLEEIVKTS
TGGVFNNAAQIWNHTFYWHCLSPNGGGAATGAIADAINSAFGSFDAFKAQFTESAINNFG
SSWTWLVKNADGSLAIVNTSNAATPLTEAGVTPLLTVDLWEHAYYIDYRNARPNYMDAFW
NLVNWDFVNENFA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgaactacctgcactgccgtacgcaaaagatgcattggagccccacatctcc
gccgagaccctggagttccaccacggtaaacaccatgccacttacgtcaccaagctgaac
ggcctggttgaaggtaccgagctggctggcaagtctctggaagagatcgtcaagacctcc
accggcggtgtattcaacaacgcagcccagatctggaaccacaccttctactggcactgc
ctgtccccgaacggtggtggtgccgccactggtgccatcgctgacgccatcaacagcgcg
ttcggttccttcgacgcctttaaagcccagttcactgagtccgccatcaacaactttggc
tcctcctggacctggctggttaagaacgccgacggcagcctggccattgtaaacaccagc
aatgccgctaccccgctgaccgaagccggtgttaccccgctgctgaccgtagacctgtgg
gaacacgcttactacatcgactaccgcaacgcccgtccgaactacatggacgcgttctgg
aacctggtgaactgggatttcgttaacgaaaacttcgcctga

DBGET integrated database retrieval system