KEGG   Ferrimonas balearica: Fbal_2807
Entry
Fbal_2807         CDS       T01318                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00230  Purine metabolism
fbl00240  Pyrimidine metabolism
fbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Fbal_2807
   00240 Pyrimidine metabolism
    Fbal_2807
Enzymes [BR:fbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     Fbal_2807
    3.2.2.-  
     Fbal_2807
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4 GPAT_N
Other DBs
NCBI-ProteinID: ADN77009
UniProt: E1SS77
LinkDB
Position
3155299..3156657
AA seq 452 aa
MQVQVRPRGSLDQLSQLEVERLRESAASELYQLYRNCSLAVLASGLTSDDSTALFERYQE
FKVRVLRSERGIKLELTHPPEAAFVDGEIIRSIQEHLFAVLRDILYISDRYENLRHINLT
NSVHITNVVFEILRNAKVISPKGETNMVVCWGGHSINDLEFQYTREVGYELGLRDLNICT
GCGPGAMEGPMKGAAIAHAKQRIRDGRFLGLTEPSIIAAEPPNQIVNELVILPDIEKRLE
AFVRLAHGIIIFPGGVGTAEELLYLLGILLHEENRDQPLPVVLTGPQSSRAYFDEINAFI
GATLGPEAQSRYHIIIDDPQAVARYMKQQLADVKSFRLSVDDAFAFNWRLKIEPEFQLPF
EPDHDTMANLDLRPMANKAMLAGHLRKAFSGIVAGNVKSQGVKAIRQRGPFRIHGDPAMM
ARLDTLLSAFVDQGRMKLPGSVYHPCYEIQPR
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcaggtacaagtgcgtccccggggcagtctcgatcaactgtcccaactggaagtggaa
cggctgcgcgagagtgccgcctcggaactctaccaactctaccgcaactgctccctggcg
gtgctggcctccggcctcaccagtgacgacagcaccgccctgtttgaacgctaccaggag
tttaaggtccgggtgctgcgcagcgagcgcggcatcaagctggaactgacccacccgccg
gaagccgcctttgtggacggcgaaatcatccgcagcatccaggagcacctatttgccgtg
ctgcgggacatcctctacatcagcgaccgctacgagaacctccgccacatcaacctcacc
aactcggtgcacatcaccaacgtggtgttcgagatcctgcgcaatgccaaggtgatcagc
cccaaaggggaaaccaatatggtggtgtgttggggtggccacagcatcaacgatctggag
ttccagtacacccgcgaggtgggttacgagctgggcctgcgcgacctcaacatctgcacc
ggctgtggccccggcgccatggaggggccgatgaagggcgccgccattgcccacgccaag
cagcgcatccgcgatggccgttttctcggcttgaccgagccctccatcatcgccgccgag
ccgcccaaccagatcgtcaatgaactggtgatcctgccggatatcgagaagcgtctggag
gcgtttgtgcgcctggctcacggcatcatcatcttccccggcggcgtcggcactgcggag
gagctgctctacctgctggggatcctgctccacgaggagaaccgggaccagcccctgccg
gtggtgctgaccgggccccaaagcagccgcgcctacttcgacgagatcaacgcctttatc
ggcgccaccctcggccccgaagcgcagagccgctaccacatcatcatcgacgacccgcaa
gccgtagcgcgctacatgaagcagcagctggccgacgtcaaatcgttccgcctctccgtc
gacgatgccttcgcgtttaactggcgcctcaagattgagccggagttccagctgccgttt
gagccggaccacgacaccatggccaatctcgatcttcgccccatggccaacaaagcgatg
ctggctggccatctgcgcaaagccttctccggcattgtcgccggcaatgtgaagtcccag
ggcgttaaagcgatccgccagcgcgggccattccgaatccacggcgacccggccatgatg
gcccgactcgataccctgctcagcgctttcgttgatcagggccgcatgaagctgcccggc
agcgtctatcacccctgttacgagatccaaccccgatga

DBGET integrated database retrieval system