KEGG   Ferrimonas balearica: Fbal_2964Help
Entry
Fbal_2964         CDS       T01318                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fbl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Fbal_2964
Enzymes [BR:fbl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Fbal_2964
Transporters [BR:fbl02000]
 Other Transporters
  Pores ion channels [TC:1]
   Fbal_2964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: ADN77166
UniProt: E1STD2
LinkDB All DBs
Position
3332250..3332879
Genome map
AA seq 209 aa AA seqDB search
MITLYGFPKSRSLRISWLLEELGLPWQYHLVNFTQREHRSPEYLAINPAGKIPALTNGDL
TLTESGAIALYLAKRYGKGRFLPVAGSDEDALHDFWLCYILTELEQPLWTMGKHKFALPP
SQRVEAVLATAQWEFAKALKEVEARIPEQGFLLGDEPTVADILLAHTLSWAAAFKQPLSP
VADAFRARLTDRPARARALEKESAALPAD
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccctgtacggatttcccaagtcccgctcgcttcgcatcagttggctgcttgag
gagctcggcctcccctggcagtaccacctggtgaacttcacccaacgggagcaccgcagc
cccgagtacctggccatcaatcccgcaggcaaaatcccggcgcttaccaatggtgatctg
accctgaccgagtccggcgccattgcgctctatctggccaaacgttacggcaaagggcgc
ttcctccctgttgccggcagcgatgaagacgccctgcacgatttctggctctgttacatc
ctgaccgaactggagcagccgctctggaccatgggcaaacacaagttcgccctgccgccg
tcacagcgggtggaggccgttctggccacggcccagtgggagttcgccaaggcattaaaa
gaggttgaggcgcgcattcctgagcaggggtttctgctgggtgatgagccgacggttgcc
gacattcttttggcccacaccctgagctgggccgccgcatttaagcagccactgagcccg
gtcgccgatgcgttcagagcccgcctgaccgaccgccccgcccgggccagggcactggag
aaggagagtgcggcactgcccgcagactaa

DBGET integrated database retrieval system