KEGG   Ferrimonas balearica: Fbal_3205Help
Entry
Fbal_3205         CDS       T01318                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
fbl  Ferrimonas balearica
Pathway
fbl00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fbl00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Fbal_3205
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fbl01003]
    Fbal_3205
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fbl01011]
    Fbal_3205
Enzymes [BR:fbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Fbal_3205
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Fbal_3205
Glycosyltransferases [BR:fbl01003]
 Polysaccharide
  Bacterial polysaccharide
   Fbal_3205
Peptidoglycan biosynthesis and degradation proteins [BR:fbl01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Fbal_3205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase UB2H UvrB_inter
Motif
Other DBs
NCBI-ProteinID: ADN77404
UniProt: E1SVV3
LinkDB All DBs
Position
complement(3616846..3619245)
Genome map
AA seq 799 aa AA seqDB search
MAKTPNNNAPGAETKRKRAPSTSKAKAKTGTRAKAKPKPKPAAQRSWWRRAALMMGKLAL
VGLAVVALYGLYLDTQIARKFEGQRWYLPAQVFARPMSLYPGAPVTHMQLKQELALLGYR
NTGTAASEGEFAVAVGRIEIYRRAFDGPNGYESPMRVMVHFSENRVTRLVRSSDSRDLGF
LQLEPLLLDRIITGNTEDRLFVPREGIPESLVSALLRTEDNQFYQHHGLSFTGIARAALA
NLKAGRTVQGGSTLTQQLAKNFFLTRDRTLVRKANEALMALIIDARYSKDEILEAYLNEV
YMGQDGKIAIHGVGLAAWHYFGTPLDELNLAQQALLVAMIKGPSYYNPWRYPERAMQRRD
LVLKLMIEEGLISPRQYSTYTQMDLALRDPNWRQRHKLPAFRTMMQRELAQRFGDNILNQ
SGLKVYTTLDPLAQRAAEKAVEQGMAQMVRDRKDDKLQAAMVVVDRYNGGVLALVGDRDP
SYLGFNRALDARRPVGSLLKPFVYETALEAPQQFSLATPLKDEPISLKSGGGQVWSPQNV
DKKFRGQASLLDSLVYSYNVPTVNLGMAIGLEPVISTLRKSGWPDRITPNPALLLGALDA
SPLQVAQLYQTLADSGRYRPVYAIGHVLNKEGERLVEQKSTSEQVLSPQATWLTNYAMTQ
VVERGTARRLKQQFPHTTLAGKTGTTTAGRDAWYAGFDDRDVVVTWVGRDDNSDAGLYGS
SAALPLYQRYLDEREPLSLVLTRPGNIVNGHFQTASGVPVASDCIDAVALPADAASWPDP
RGCQGGERAKNWLERIFSF
NT seq 2400 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagactccgaacaacaacgcgccgggcgcggaaaccaagcgcaaacgcgcgccc
tcaaccagcaaagcgaaggccaaaaccggcacccgggcaaaggccaagccgaaacccaaa
ccggccgcgcagcgctcatggtggcggcgtgccgcgctgatgatgggcaagctggcgctg
gtcggcctggccgttgttgccctgtatggcctctacctggatacccagattgcccgcaag
tttgagggccagcgctggtatctgccggcgcaggtgtttgcccgtcccatgagtctctat
cccggtgcgccggttacccacatgcagctcaagcaggagctggcactgctgggctaccgc
aataccggcaccgcggcctctgagggcgaatttgccgtggcggtggggcgcatcgagatc
taccgtcgtgccttcgatggccctaacggctatgagtcgccgatgcgggtgatggtccac
ttcagtgagaaccgggtaacccgactggtgcgctccagtgacagccgtgacctcggcttc
ctgcagctcgaacccctgctgctggatcgcatcatcaccggcaacaccgaagaccgtctg
tttgtcccccgtgaggggatcccggagtcgctggtgtcggcgctgctgcgcaccgaggac
aaccagttctaccagcaccacggcctctcctttaccggcattgcccgggcggcgctggcc
aaccttaaggcgggccgcaccgtgcaggggggcagtaccctgacccagcagctggccaaa
aacttcttcctgacccgtgatcgcaccctggtgcgcaaggccaacgaagcgttgatggcg
ctgatcatcgacgcccgttacagcaaggatgagatcctcgaggcctacctgaacgaggtc
tacatgggccaggatggcaagatcgccatccatggtgtggggctggcggcctggcactac
ttcggcacgccgctggatgagctgaacctggcccagcaggcgctgctggtggcgatgatc
aaggggcccagctactacaacccctggcgctacccggaacgcgccatgcagcgtcgtgat
ctggtgctcaagctgatgatcgaagaggggctgatctcgccgcgtcagtacagcacctac
acccagatggatctggccctgcgcgaccccaactggcgccagcgccataaactgcccgcg
ttccgcaccatgatgcagcgtgagctggcccagcgctttggcgacaacatcctgaatcag
tccggcctgaaggtgtacaccaccctcgatccgctggcccagcgtgccgccgagaaagcg
gtggagcaggggatggcgcagatggtacgggaccgcaaagacgacaagctgcaggccgcc
atggtggtggttgaccgctataacggcggggtgctggcactggtgggcgaccgtgacccc
agctacctcggcttcaaccgggcactggatgcccgccgtccggtgggctcgctgctgaaa
ccctttgtctacgaaaccgcgctggaagccccgcagcagttcagcctggcgacgccgctg
aaggatgagccgatcagcctgaaaagtggcggtggccaggtgtggtcgccccagaacgtg
gataagaagttccgcggccaggccagcctgctggacagcctggtgtactcctacaacgtg
cctacggtgaacctggggatggccatcggccttgagccggtgatcagcaccctgcgcaaa
tccggttggcccgatcgcatcacccccaacccggccctgttgctgggggcgctggacgcc
agcccgttacaggtggcccagctctaccagaccctcgccgacagtggtcgctaccgcccg
gtctatgccattggccatgtgctgaacaaagagggcgagcgactggtggaacagaagagc
acctcagagcaggtgttgtcgccccaggccacctggctcaccaactacgccatgactcag
gtggtggagcgcggtacggcacgacgcctgaagcagcagttcccccacaccaccctggcg
ggcaaaaccggcaccactaccgccggtcgtgatgcctggtatgccggctttgatgaccgt
gacgtggtggtgacctgggtcggccgcgacgacaactccgatgccgggctctatggcagc
tccgctgcgctgccgctgtaccagcgttacctggatgagcgggagccgctgtcgctggtg
ctgacccgtccggggaacattgtgaatggccatttccagaccgcctccggcgtgccggtg
gcatcggactgcatcgatgcggtagcgctgccggcggacgccgccagctggcctgacccc
cgtggttgccaggggggtgaacgggctaaaaactggctggagcggatttttagtttctaa

DBGET integrated database retrieval system