KEGG   Flavobacterium branchiophilum: FBFL15_0649Help
Entry
FBFL15_0649       CDS       T01625                                 

Gene name
kynU
Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00380  Tryptophan metabolism
fbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    FBFL15_0649 (kynU)
Enzymes [BR:fbr01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     FBFL15_0649 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CCB68762
UniProt: G2Z602
LinkDB All DBs
Position
762306..763586
Genome map
AA seq 426 aa AA seqDB search
MIFKNTLQFAQQWDAQDALRDYKNQFHFPKHNGKNVIYFTGNSLGLQPKQTQKYIDEIMN
DWANLAVEGHFFAQKPWWDYQERFKVPLSKLVGAKPSEVTVMNTLTVNLHLLMVSFYNPK
PSKYKILCEEKAFPSDQYMLQSQVQFHGYDPSDAIITVKRRPGEHHIRTSDVLDLLDQHG
HEIALVLMGGVNYYTGQVFDIEQITKKGQAHGAHVGWDLAHAAGNIHLDLHQWGVDFAAW
CSYKYMNAGPGNVSGCFIHEKHHQLQLPRFAGWWGHDKKTRFKMDDTFCPSEGADGWQIS
NLPVLSLAPYWAAIEMFDKIGMPTLIQKRNQITAYLDFILQTINQEVAGHFEIITPTNPN
ERACQLSVFLHGEGRELFDFLMANGVIVDWREPNVIRLAPVPFYCSFEDMYHFGQILKAG
ILNKNL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgatttttaaaaatactttacaatttgcacaacaatgggatgctcaagatgcacttcga
gattataaaaatcaattccattttcccaaacacaacggtaaaaatgtgatttattttaca
ggaaactctttaggacttcagcccaaacaaactcaaaaatatatagatgaaatcatgaac
gattgggcaaatttagctgtcgaaggccacttttttgctcaaaaaccttggtgggattat
caagaacgtttcaaagtgcctttaagtaaattagtaggggcaaaaccatccgaagttacc
gtaatgaatacgctaactgtaaatttgcacttgctaatggtgtcattttacaatccaaaa
ccatcaaaatataaaatattgtgcgaagaaaaagcatttccttctgatcaatacatgtta
caaagtcaggttcaatttcatggatacgacccttccgatgccatcattaccgtcaaacga
cgtcctggcgaacaccatattagaacctcagacgttttagacttattggaccaacatggg
catgaaatagccctggttttgatggggggtgtcaattattatacaggacaagtatttgat
attgaacaaattaccaaaaaagggcaagcccacggtgctcatgtgggttgggatttggca
catgcagctggcaatattcacttggatttgcaccaatggggtgttgattttgcagcatgg
tgcagttacaaatacatgaatgctgggcctggtaatgtgtcgggttgttttattcacgaa
aaacaccatcaattgcaacttcctcgatttgcgggttggtggggacacgataaaaaaacg
agattcaaaatggacgacaccttttgcccttcagagggggcagatggctggcaaattagc
aatttgcccgttctttcgttagctccatattgggctgccatcgaaatgtttgacaaaata
ggtatgccaacattaattcaaaaaagaaatcaaataacggcttacctcgattttattttg
caaactatcaaccaagaagttgcgggtcatttcgaaatcattaccccaacaaatcctaac
gaaagggcttgtcaattgtctgtttttttgcatggcgagggccgagaattgttcgacttt
ttaatggcaaatggcgttattgtcgattggcgagaacccaatgtgattaggcttgctcca
gttcctttttattgttcgtttgaagatatgtaccattttggacaaattttaaaagcaggt
attcttaataaaaatttataa

DBGET integrated database retrieval system