KEGG   Flavobacterium branchiophilum: FBFL15_1657Help
Entry
FBFL15_1657       CDS       T01625                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fbr  Flavobacterium branchiophilum
Pathway
fbr00620  Pyruvate metabolism
fbr00680  Methane metabolism
fbr01100  Metabolic pathways
fbr01120  Microbial metabolism in diverse environments
fbr01200  Carbon metabolism
Module
fbr_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fbr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FBFL15_1657 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    FBFL15_1657 (ppc)
Enzymes [BR:fbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     FBFL15_1657 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CCB69718
UniProt: G2Z1F0
LinkDB All DBs
Position
complement(1940286..1942871)
Genome map
AA seq 861 aa AA seqDB search
MYTLPKIERFNQGVLSKYHIYNSVFITLPFDSINNTGALLPLFSDICENGFKNHQTPVEI
VETFAAKYLDHNNEAQRIELMFRFIQYIERQIVLFDAIEDAAFPVVNNMEGRGSLRDIKE
KADVKNKQTELIDFLENFSVRTVLTAHPTQFYPGSVLGIINDLTDAIRANDLLYIKQLLA
QLGKTPFIKKEKPTPFDEAVSLIWYLENVFYETSGEMVHYLQKNIFEGQSIQNKLIKLGF
WPGGDRDGNPFVTTEITLKVADRLRTSILKCYYLEIRKLKRKLTFYNIETLMSDIEEKLY
RSVFYSKGDIFITLEEFLTQLNLIKNIIIAEHQSLYLDELEALLIKVNLFGFHFATLDIR
QNSKIHNEVFTNLVDYYRLSVQNIFPKNYFELSENEKLDILGRVQAKTDIHFSDNKIVQS
TIESIYAIKQIQDKNGEFGANRYIISNNESALNVMEVFAMFRLCGWQNPTVDIVPLFEVI
DDLQSADKIMEQLYTNKAYAEHLKNRGYKQTVMLGFSDGTKDGGYLMANWSIYKAKETIS
AISRKYNIKVIFFDGRGGPPARGGGKTHKFYASLGPNIENQEIQVTVQGQTISSNFGILD
SCRYNLENLLSAGVANQVFNKEDNILSEKDKNILDELAQKGYEKYTNFKNHPQFIPYLEK
MSTLKYYAKTNIGSRPSKRSKSENLDFADLRAIPFVGSWSQLKQNVPGFFGVGAALKFFE
DENRWIEVQNLYDNSLFFKTLLENSMMALAKSFFPLTEYMKNDPVFGDFWQIIYNEFLET
KRLLLKIANHQSLMENYPDGKASIEMREKIVMPLLTIQQYALLKIKELSAETQPNLELIQ
VYEKIVTRSLFGNTNASRNSA
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtacacattacccaaaatcgaacgtttcaatcaaggtgtattgtctaaataccacatt
tataatagtgtgtttattaccttgccttttgattctatcaacaatacaggggcattatta
cccttattttcagatatttgcgaaaatggtttcaaaaatcatcaaacccccgttgaaatt
gtagaaacttttgctgccaagtatttagaccacaacaacgaagcccaacgcatcgaattg
atgtttagatttattcaatacatcgaaagacaaattgttttgtttgatgctattgaagat
gccgcttttcctgttgtaaacaatatggaaggaaggggctctttgagggatatcaaagaa
aaagccgatgtaaaaaacaaacaaacggagttaattgattttcttgaaaattttagcgtt
agaactgtcttaacagcgcaccccacgcaattttatccaggatctgttttaggtatcatc
aacgatttgaccgatgccattagagccaacgatttactatacatcaaacaacttttggca
caattgggcaaaacaccttttattaaaaaagaaaaaccaaccccttttgacgaagcagta
agtttaatatggtatctcgaaaatgttttttatgaaacctcgggcgaaatggttcattat
ttgcaaaaaaatatttttgaaggccaatctattcaaaataaattaatcaaattaggcttt
tggccaggtggcgatagagatggaaacccgtttgtaactaccgaaattacacttaaagta
gcagatcgattaagaacttctatcttaaagtgttattacctcgaaattagaaaactcaaa
cgtaagctaactttctataacatagagactttgatgtccgatattgaagaaaaactttat
cgttctgtattttattctaaaggcgatatttttattactttggaggaatttctaacccaa
ttaaatctcatcaaaaacataattattgccgaacatcaatcgctttatttggacgaactc
gaagcacttttaattaaagtaaatttgttcggatttcattttgctactttagatattcgt
caaaacagcaaaattcacaacgaagttttcacaaatttagtcgattattaccgtttatct
gttcaaaatattttcccaaaaaattattttgaattgtccgaaaacgaaaaattagatata
ctaggtagggtacaagccaaaacagatattcatttttcagataataaaattgtacaatct
actatcgaatccatttatgcaatcaaacaaattcaagacaaaaatggcgaatttggtgcc
aatcgatacatcattagcaacaatgaaagtgccctcaatgtgatggaagtttttgccatg
ttccgtttgtgcggctggcaaaatcctaccgtagatattgtgccactttttgaagtgata
gacgacttgcaaagtgccgacaaaattatggaacaattatacaccaataaagcctatgct
gaacacctcaaaaatagaggctacaagcaaacggttatgctcggtttttcagacggaaca
aaagatggtggctacctcatggccaattggagtatatataaagccaaagaaaccatatcg
gcaatttctagaaaatacaacatcaaagtcatcttttttgatggtcgtggtggccctcct
gcccgtggtggtggcaaaactcacaagttttatgcctcgttaggccccaacatcgaaaac
caagaaattcaagttactgttcaaggtcaaactattagttccaattttggtattttagat
tcttgccgatacaacctcgaaaatttattaagtgccggtgttgcaaatcaggtttttaat
aaagaagacaatattttgtctgaaaaagataaaaatattttggacgaattggctcaaaaa
ggttacgaaaaatataccaatttcaaaaaccaccctcaatttatcccttatttggaaaaa
atgagtaccctaaaatattatgccaaaaccaatattggtagcagaccttctaaaagaagc
aaatcagaaaatttggattttgccgatttaagagccattccttttgttggatcttggagc
caactcaaacaaaacgttcctggattttttggagtaggggcagccctcaaattttttgaa
gacgaaaatcgttggattgaagtccaaaatttgtatgataattctttgttttttaaaaca
cttttggagaatagtatgatggctcttgccaaatcttttttccctcttactgaatatatg
aaaaatgaccccgtttttggcgatttttggcaaattatttacaacgaatttttagaaacc
aaacgactgttactcaaaattgccaatcaccaatcactcatggaaaattatccagacggt
aaagcatctatcgaaatgagagaaaaaattgtgatgcccttattaaccattcaacaatat
gctttgctgaaaatcaaagagttatctgcagaaacccagccaaatcttgaattgattcaa
gtatatgaaaaaattgtaactcgttcattatttggcaataccaatgcaagtagaaattct
gcttaa

DBGET integrated database retrieval system