KEGG   Flavobacterium branchiophilum: FBFL15_1932Help
Entry
FBFL15_1932       CDS       T01625                                 

Definition
(GenBank) Probable type II restriction endonuclease
Organism
fbr  Flavobacterium branchiophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RE_ApaLI
Motif
Other DBs
NCBI-ProteinID: CCB69981
UniProt: G2Z232
LinkDB All DBs
Position
2265644..2266279
Genome map
AA seq 211 aa AA seqDB search
MDELIQNIKNLAEVYSANLKGKIEARTEEMKADDNSHYLIYRVLGINLQEEQLIDQYQNT
GRFLYKYAGSFLEEAASLCLNYKYPVGIKTKVENTIGHRPKTFEIDFLNANDAIEVKWRV
ATTDGDHITKEHTRVQVIRNHGYKPIRVMFYYPQREQAIRIQQTLKTLYAGVEGAYYGGD
EAWEYSKAYSGVDLKAILTQNANERTPENGN
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattaatacaaaatataaagaatctagccgaagtttattctgcaaatttgaaa
ggaaaaattgaagcaagaacagaagaaatgaaagccgatgacaactctcattatcttatt
tatcgtgttttaggtattaacttacaagaagaacaattgattgaccaatatcagaacaca
ggacgatttctttataagtatgcaggttcgtttcttgaagaagcagcaagtttatgttta
aactataaatatcctgttggaataaaaactaaagtagaaaacacgatagggcaccgacca
aaaacatttgaaattgattttctaaatgccaatgacgcaattgaagttaaatggagagtc
gctactactgacggagaccatattacaaaagaacatacgagagttcaagtaatacgaaat
cacggatataaacctattagagttatgttctattacccacaaagagaacaggctattaga
attcaacaaactctaaaaacactttatgcaggtgtggaaggagcatattatggcggtgat
gaagcttgggaatactcgaaagcttattcaggagttgacctaaaagctattttgacacag
aatgctaacgagaggacacccgaaaatggaaactaa

DBGET integrated database retrieval system