KEGG   Flammeovirgaceae bacterium 311: D770_03010Help
Entry
D770_03010        CDS       T04058                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00620  Pyruvate metabolism
fbt00680  Methane metabolism
fbt01100  Metabolic pathways
fbt01120  Microbial metabolism in diverse environments
fbt01200  Carbon metabolism
Module
fbt_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D770_03010
  09102 Energy metabolism
   00680 Methane metabolism
    D770_03010
Enzymes [BR:fbt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D770_03010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHM58869
UniProt: A0A0D3LAK1
LinkDB All DBs
Position
complement(759692..762274)
Genome map
AA seq 860 aa AA seqDB search
MSSKTGSNPLTVYKNLVGIKFQLYNSLFTSLPFHRIEKTGILLTMFLIHCEEGYANNQSP
DEIIQSFLAQFTNYKATKEKNDLLFRFIQYAERQVVLFDALEDAAFSKINDTGGAGTLKH
LSSEVTVKQATGKLGEKLKNFAVRLVLTAHPTQFYPGSVLGIIHDLSKSLQNENSAQVNS
YLQQLAITPFFKKERPTPFGEARALIWFLQNTFYPAAGNILSSLQQQYPGVVDLHNPVIR
LGFWPGGDRDGNPFVKVDTTLQVAEELRAAITVSYYRDVRTMKRRLTFKGVEAPLTQLEQ
KLYNNIFVPGHKADITKQEIVDTLMNICNTLNEKYNGLFVSKVENLIAKVEIFGLFFASL
DIRQDSSVHGAMLEVIAKKSGAIPENYAAFTDQEKIAALLDIKEEVDPSVLEDELFRDAL
ETMKAIKTIQKINGEEGCHRYIISHSTKALSVLEVFGLLQMSGWKREELTIDIVPLFETI
DDLVAAPAIMQELYQTPFYKEHLDRRNNIQTIMLGFSDGTKDGGYLMANWSIYKAKEELT
RVSRENGIQVVFFDGRGGPPARGGGKTHQFYASMGKNIENKEIQLTIQGQTISSNFGIID
SAQYNMEQLMHAGISNELFRAEEVTVDKEDEKAFQELAQESYNEFNKIKHNPLFLEYLTS
ASPLRYYSETNIASRPSKRNKDKKITLDDLRAVPYVGSWSQIKQNLPGYYGVGSALQKME
EDGKWDKVQHLYNNSLFFRTLMGNCEMAMSKAFFPLTQYFSKNPVYGELWNNFYEEYKRS
KQYVLKLSGKNELMDDRPVDQLSIQMRQRIELPLTTIQQYALSKIREIEEGGGDAQLKEV
YEKMVVRCSFGIINAERNSA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtaaaaccgggagtaaccccttaacggtttataaaaacctggtgggaattaaa
tttcagctctacaacagcctttttacttctttaccttttcacagaatagaaaagaccggc
attttgttgacaatgttcctgattcactgcgaagaaggctatgccaataaccaaagtccg
gatgaaatcatacaatcttttctggcccagtttaccaactataaggcaaccaaagaaaaa
aacgacctgctcttcaggtttattcagtatgcagagcggcaggtagtgctgtttgatgcc
ctggaagatgctgccttcagcaaaatcaatgatactggtggtgcaggtacccttaagcat
ttaagctctgaagtaacagttaaacaagccacaggcaaactgggggagaagctgaaaaac
tttgcagtaagactggtgcttacagcccaccccacacaattttaccccggctcggtttta
ggcattattcacgatctttctaagtcactgcagaacgaaaacagtgcacaggtaaattca
tacctgcagcagcttgccataacaccattcttcaaaaaagagcggccaacgccattcggg
gaggccagggcactgatctggtttttacaaaatactttctacccggctgccggcaatatc
ctttcaagtctgcagcagcagtaccccggcgttgtagacctgcacaatccggtaatccgc
ctaggcttctggcctggtggcgacagggatggcaacccctttgtgaaggtagatactacg
ctgcaggtagcagaagaattacgggctgctattacggtttcttactaccgcgatgtaaga
accatgaaaaggcgcttaaccttcaaaggagttgaagctcctttaacccagctggagcaa
aagttgtacaataacatttttgttccgggtcacaaagcagatatcacaaagcaggagatt
gtagatacccttatgaacatctgcaataccctgaatgagaagtacaatggtttgtttgtt
tccaaagtagaaaatctgattgccaaggttgagatctttgggcttttctttgcctctctg
gatatacgacaggatagctccgtacatggcgccatgctggaggtaattgctaaaaaatct
ggtgcaattccagaaaactatgctgcctttacagaccaggaaaagattgctgccctgctg
gatatcaaagaagaggtagatccgtcagtgctcgaggatgagctgttccgggatgctctt
gaaaccatgaaggcaattaaaacaattcagaagatcaatggcgaagaaggttgccatcgg
tacatcatcagccactccacaaaggctcttagtgtgctggaggtattcgggctgctgcaa
atgagcgggtggaagcgtgaagaactcactattgatattgttcctttgttcgaaaccata
gacgacctggtggcagcacctgctattatgcaggagttgtaccaaactcctttctataaa
gagcacctggacaggagaaataacatccagaccattatgctgggcttttcagatggcacc
aaagatggtggttacctgatggcaaactggagtatatacaaagccaaagaagagctcacc
cgggtatccagggaaaatggtatacaggttgttttttttgatggcaggggaggacctccg
gcgcgtggtggaggaaaaacccatcaattttatgcctcaatgggtaaaaatattgaaaat
aaggaaattcagctgaccattcagggacagacgatcagctccaatttcggtattatagat
tctgcccagtacaacatggagcagttgatgcatgccggcatcagcaatgagttattccgg
gcagaagaggttacagtagacaaggaagatgaaaaagcctttcaggaacttgcacaggag
agctacaacgagtttaataaaataaagcataatcccctgttcctggagtatcttaccagt
gccagccccttgcgctactattccgaaacaaatattgccagcaggccctctaagcgtaac
aaggataagaaaatcacgcttgatgatctaagagcagtgccttatgtaggctcctggagc
cagataaagcaaaacttaccgggatattatggcgtaggttctgccctgcaaaagatggag
gaagatggtaaatgggataaggtacagcacctgtacaataactctcttttcttcagaaca
cttatgggcaattgcgaaatggctatgtccaaagctttctttccgctaactcagtacttt
tctaaaaatcctgtttatggtgagctctggaataatttttacgaagagtacaaaaggagt
aagcagtatgtgctgaagctttccggtaaaaatgagcttatggatgacaggccggtagac
cagctatctatacagatgcgccagcgcattgagcttccacttaccaccatacagcagtat
gctttaagcaaaatcagggaaatagaagaaggtggtggcgatgcccagttaaaagaggtt
tatgaaaaaatggtagtccggtgctcctttggtatcatcaacgcagaaagaaactctgct
taa

DBGET integrated database retrieval system