KEGG   Flammeovirgaceae bacterium 311: D770_09275Help
Entry
D770_09275        CDS       T04058                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00010  Glycolysis / Gluconeogenesis
fbt00020  Citrate cycle (TCA cycle)
fbt00620  Pyruvate metabolism
fbt01100  Metabolic pathways
fbt01110  Biosynthesis of secondary metabolites
fbt01120  Microbial metabolism in diverse environments
fbt01130  Biosynthesis of antibiotics
fbt01200  Carbon metabolism
Module
fbt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D770_09275
   00020 Citrate cycle (TCA cycle)
    D770_09275
   00620 Pyruvate metabolism
    D770_09275
Enzymes [BR:fbt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     D770_09275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C Peptidase_M23 HlyD_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: AHM60112
UniProt: A0A0D3LEG6
LinkDB All DBs
Position
complement(2179018..2180703)
Genome map
AA seq 561 aa AA seqDB search
MAEVIRMPKMSDTMEEGVIASWQVKVGDKIKSGDVLAEVETDKATMELESYQDGVLLHIG
VQEGDAVPVNAIIAVIGEKGEDVSSLLKEEGGASEGKSEDKKEAKEEQKDAAPQAKAEKK
AAPAVDVSKIKASVIRMPKMSDTMQEGVIAAWHKKVGDKVSSGDLLAEVETDKATMELES
YEDGVLLHIGIEEGNSVPVDGVIAVIGEKGADFQALLQAEETGGSQEEEATEAPATAKAP
AEAASSNGQGSQPTVQAAASSADDSRVKASPLARKMAEEKGYTLSQIKGTGPDGRIVKKD
VEDFKPEAATAQPQAAPGQKADKQPSIQLPQVIGEERFEDRKISQMRKTIAKRLAESKFT
APHFYLTMEIDMDKAISSRESLNQISPVKISYNDMVIKAAALALRKHPDVNVSWQGDTMR
YNQHVNIGVAVAVPEGLLVPVVRFADTKTLSHISAEVKDLGGKAKNKQLQPKDWEGSTFT
ISNLGMFGIDEFTAIINPPDACIMAVGGIKQTPVVKDGQIVPGNIMKVTLSCDHRAVDGA
VGAAFLQTFKGLLEDPIRMLV
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaatccgcatgcccaagatgagcgacaccatggaagaaggggtgatcgca
tcatggcaggtaaaggtaggagataaaataaaatcaggagatgtactggcagaagtagaa
accgacaaggctactatggagctggaatcatatcaggacggtgtgctcctgcacattggc
gtacaggaaggcgatgctgttcctgtaaatgccatcatcgccgtaattggcgaaaaaggt
gaagatgtcagcagcctgctgaaagaggaaggtggagcctccgagggtaaatccgaagat
aaaaaagaagccaaagaagaacagaaagacgctgccccacaggcaaaagctgaaaagaaa
gctgcccccgcagtggatgtatcaaaaattaaggcttcggtaatccgtatgcctaaaatg
agcgataccatgcaggagggtgtaatagccgcctggcataaaaaagtaggagataaggta
tccagcggcgatctgctggccgaagtggaaactgataaagctaccatggagctggagtct
tacgaagatggcgttctgctccacattggtattgaagaaggcaacagcgtacctgtagac
ggtgtgattgccgtgattggcgaaaaaggtgctgactttcaggcattgctgcaggccgaa
gagaccggcggcagccaggaagaagaagccacagaagcaccggcaactgctaaggcacca
gcagaagcagcttcctcaaacggacaaggcagccagccgaccgtacaagctgcagcttcg
tcagcggacgacagccgcgtaaaagcttctccattagcccgtaaaatggcggaggagaaa
ggctacaccctgagccagattaaaggcacggggcctgatggacgcattgttaagaaagat
gtagaagactttaaaccggaagctgctactgcacagccacaggctgctcccggacaaaaa
gcagacaagcaaccaagcatacagctgccacaggtaataggtgaggagcgcttcgaagac
cgcaagatctcccaaatgcgcaaaaccattgccaaacgcctggccgaaagcaagtttacg
gcgccgcatttctacctcaccatggagattgatatggacaaggctatcagctcacgcgaa
agcctgaaccagatctctccggtgaagatatcttacaacgatatggtgatcaaggcagcg
gcacttgccctgcgcaagcaccccgatgtaaacgtaagctggcagggcgataccatgcgc
tacaaccagcacgttaatataggggtggcggtagcagtgcccgaaggactgctggtaccg
gtagtacgttttgccgataccaaaacccttagccatatctctgccgaggtgaaagacctt
ggtggtaaagccaagaacaagcagctgcagcctaaagactgggagggaagtacctttacc
atctctaatctgggtatgtttggcatcgatgaatttacagccatcattaatcctccggat
gcctgcatcatggcggtgggtggcattaagcagacccctgtggtgaaggacggacagatt
gtacccggcaacatcatgaaagtaacgcttagctgcgaccaccgagccgtagatggtgcc
gtgggtgccgccttcctgcaaaccttcaaaggcctgctggaagatccgatcagaatgtta
gtttaa

DBGET integrated database retrieval system