KEGG   Flammeovirgaceae bacterium 311: D770_12850Help
Entry
D770_12850        CDS       T04058                                 

Definition
(GenBank) Kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00380  Tryptophan metabolism
fbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    D770_12850
Enzymes [BR:fbt01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     D770_12850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AHM60824
UniProt: A0A0D3LG09
LinkDB All DBs
Position
3043158..3044459
Genome map
AA seq 433 aa AA seqDB search
MQYQNTESFARELDQQDPLASFRERFLFPIVADESKEGMKTAIYLCGNSLGLQPKATRTY
LERELQKWAQYAVDGHFHAEEPWLTYHKLLREPLARLVGAQPHEVVAMNNLTTNLHLMMV
SFYRPGPQRYKILMEGGAFPSDQYAVESQVRFHGYAPDSAIIEINPRPGEQTLHTEDILA
AIEEHKDSLALVLFSGIQYYTGQVFDMQAISKAAHAAGAFAGFDLAHAIGNVPMQLHNWD
ADFAVWCSYKYLNSGPGNTAGAFVHERHVTSTDIPRFAGWWGHNEEERFKMEKGFKPIAG
ADGWMLSNSNILPLAAQRASLEIFEEAGIERLRQKSLQLTGYLEWMLCHEINCDKWGIEI
ITPSQPEARGCQLSLFVHKGGKAVFDKIDSAGVIGDWREPNVIRVAPAPLYNSFMDVYRF
CRIFERALQEVVG
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgcaataccaaaatacggagtcttttgccagagagctggaccagcaggatccgctggcc
tcattcagggagcgttttttgtttcctattgtagccgatgagtccaaggaaggcatgaaa
acagccatttacctctgtggtaattcactgggcctgcagcccaaagctacacgcacttac
ctggagcgtgagttacagaagtgggcacaatacgcggtagatggccattttcatgccgag
gagccctggcttacctatcacaaattactgcgcgaaccgctggcccgcctggtgggggcg
cagccgcatgaggtagtggccatgaataacctcaccaccaacctgcacctgatgatggta
agcttttaccgtcccggcccgcagcggtataaaattctgatggagggtggcgctttccct
tccgatcagtacgcggtagaatcgcaggtgcgctttcatggctacgcccccgatagtgcc
atcattgagataaatccacgccccggggagcaaaccctgcacaccgaagatatcctggca
gctattgaggaacataaagacagcctggcgctggtgctctttagcggcatccagtactac
accgggcaggtgtttgacatgcaagccatcagcaaggcagctcatgccgcaggcgctttc
gccggttttgatctggcccacgccattggcaatgtgcccatgcagctgcacaattgggat
gccgattttgccgtttggtgcagctataagtacctcaacagcgggcctggcaacacagca
ggcgcttttgtacacgagcggcatgtaaccagcacagatattccgcgctttgccggctgg
tggggacataacgaagaggagcgctttaaaatggagaaaggcttcaagccaattgccggt
gctgatggatggatgcttagcaacagcaatattttaccgcttgctgcccagcgcgcctcc
ctggaaatatttgaagaggccggtattgagcgcctgcgccagaaaagcctgcagctgacc
ggctacctggagtggatgctctgccacgaaataaactgcgataaatggggcattgagatc
attacccccagccagcccgaggcacgcggctgccagctctccctgtttgtgcacaaagga
ggtaaggccgtttttgataaaatcgacagcgccggtgtaattggcgactggcgcgaaccc
aatgtgatcagggtggccccggccccgctctacaactcatttatggatgtttataggttc
tgccgtatctttgagcgcgctttacaggaagttgtgggttaa

DBGET integrated database retrieval system