KEGG   Flammeovirgaceae bacterium 311: D770_16910Help
Entry
D770_16910        CDS       T04058                                 

Definition
(GenBank) glycoside hydrolase 3 domain-containing protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00520  Amino sugar and nucleotide sugar metabolism
fbt01100  Metabolic pathways
fbt01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    D770_16910
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    D770_16910
Enzymes [BR:fbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     D770_16910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AHM61636
UniProt: A0A0D3LHQ2
LinkDB All DBs
Position
complement(4060473..4061603)
Genome map
AA seq 376 aa AA seqDB search
MMKRILAVAAATFLSAHACVAQTPVPATEKVVHPFTLEDFYRQDKLLDQQVEQIFGRMSD
EQRAGQMIIPAAGRLGKTDAQLDELARKGWMGGVILLNGTVESFKNYVHRFDSISKANGH
LPLVYSADAEPSLINRKIGGSTPVPKTAELKDTAEVMAVAHTIAHQLKEIGILYNYAPVT
DLSLQNAAIGNRSFGSDPAHVERMNRVFITTSQADGVATTAKHFPGHGLVKGDSHKKLVF
IDGPMQEVDVYKGLIQAGVLSIMIGHIAVQNNPKYNTDGQPATLSRAIVTDLLKNEMGFK
GIITTDAMNMGAVAAIPNSSLKAAQAGNDIILMPNNEKEAVFSILAQMDKDAAFKQQVYD
SVKKIIRFKLALGVIR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaagaatattagctgtggccgccgccacctttctgagcgcgcatgcctgcgtg
gctcaaacccctgtaccagcaaccgaaaaggtggtgcacccttttaccctggaagatttt
tacaggcaggacaaactgctggatcagcaggtggaacagatcttcggccgcatgagcgat
gaacagcgggcaggacaaatgatcattcctgccgccggacgtttaggcaaaaccgatgcc
cagctggatgaactggcccgcaagggctggatgggaggcgttattttactgaacggtaca
gtagagagttttaagaactatgtacatcgcttcgacagcatcagcaaagcaaacggacac
ctgccactggtatacagcgccgatgcagagcccagcctgatcaacagaaaaattggtggg
tctacgccggtacctaaaactgccgagctgaaagatactgccgaagtaatggctgttgct
cacaccattgcccatcagctaaaggaaattggcatattatataactatgcgccggtaact
gatcttagcctgcagaatgccgcaatcggcaaccgcagctttggttccgatcctgctcat
gtggagcgcatgaacagagtctttattactacctcgcaagccgatggcgtagccactaca
gcaaaacattttccgggccatgggctggtaaagggcgatagtcacaaaaagctggtattc
attgatggccccatgcaggaggttgatgtttacaaaggcctgatccaggcaggcgtacta
agtattatgatagggcatattgctgtacagaacaaccccaagtacaataccgatggccag
ccagctaccttaagccgggcaattgtaaccgacctgcttaagaatgaaatgggtttcaag
ggaattatcaccactgacgccatgaatatgggcgccgtagccgctattccaaattcatca
ctaaaagccgcgcaggccggcaacgatattattctgatgccgaacaatgaaaaagaagct
gtcttctctatcctggcacaaatggataaagatgcagccttcaaacagcaggtttatgat
tcggtaaagaagattatccgctttaagctcgcacttggagtaattcgttag

DBGET integrated database retrieval system