KEGG   Flammeovirgaceae bacterium 311: D770_16925Help
Entry
D770_16925        CDS       T04058                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00240  Pyrimidine metabolism
fbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    D770_16925
Enzymes [BR:fbt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     D770_16925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AHM61639
UniProt: A0A0D3LI97
LinkDB All DBs
Position
4063591..4064190
Genome map
AA seq 199 aa AA seqDB search
MFIEPKISGTAATGKAGWIEVICGSMFSGKTEELLRRLNRVMIARQKVEIFKPAIDTRYH
EHNVVSHNANSIRSTPVQFSEDILLLAGNCDVVGIDEAQFFDDALVEVCTKLASSGKRVI
VAGLDMDFSGKPFGPMPQLLAIAEYVTKVHAICIKCGDIAHYSYRLTPNQKTVMLGEKDT
YEARCRRCFLKGPKAEQII
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtttattgaaccaaagatttcaggtaccgccgcaacgggcaaggcaggctggatagaa
gtgatctgtggctccatgttcagcggtaaaaccgaggagctgttgcgccgcctcaaccgg
gtaatgattgcccggcaaaaagtggaaatttttaagccggccattgatacccgctaccac
gaacacaacgtggtatcgcataatgctaattctattcgctctacccccgtgcagttttct
gaagacatactgctgctggcaggcaactgcgatgtggtgggcatagacgaagcccagttt
tttgatgatgcactggtagaggtatgtaccaagctggccagcagcggcaaaagagttatt
gtggcagggctcgatatggactttagcggcaagcctttcggccccatgccccagctgctg
gccattgccgagtatgtaactaaggtacatgccatttgcatcaagtgcggcgatattgcc
cattactcctaccggctcacccccaatcaaaaaacagtgatgctgggcgagaaagatacc
tatgaagcccgctgccggcgttgttttctgaaaggccccaaagccgagcaaataatataa

DBGET integrated database retrieval system