KEGG   Flammeovirgaceae bacterium 311: D770_23540Help
Entry
D770_23540        CDS       T04058                                 

Definition
(GenBank) alpha amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
fbt  Flammeovirgaceae bacterium 311
Pathway
fbt00500  Starch and sucrose metabolism
fbt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fbt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    D770_23540
Enzymes [BR:fbt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     D770_23540
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     D770_23540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: AHM62953
UniProt: A0A0D3LM90
LinkDB All DBs
Position
5697635..5699284
Genome map
AA seq 549 aa AA seqDB search
MIGDLWYKNAVIYSLDLETFMDLNADGIGDFEGLTRRLDYLHAMGVDTVWLAPFQPTPNR
DNGYDVKDYYGVDPRHGSSGNFVEFMHQAKKRGIKVIIDLVVNHTSDEHHWFQDSRSSED
AKHRDWYVWSKKKPDDWDEGMVFPGVQDRTWTYDKKAKAYYHHRFYQFQPDLNIDNPEVR
EEITRIIGFWLELGVAGFRVDAVPFLLETQNPGETSKEIRFEYLREIRRFLQWRKGNAIL
LGEANVSPEETKDYFGFEGNGIHMMFNFYVNQYLFYALATAETKPLIKALEETRNTLPAN
QWAHFLRNHDELDLGRLSEEERKKVFARFAPEKHMQLYDRGIRRRVATMLGNRQQTELAY
SLIFSLPGAPVIRYGDEINMGDNLELEERNAVRTPMQWSDGPQAGFSKAEKLVHPVIDSG
PYAYQHVNVENQRRTPDSMLNWMTTLIRLRQECTEIGWGDWQIMETGVEQVLCMHYNWKG
SSLVILHNFDEKAHEVSLKLERDEETKLVDLMVDYVSVAEGKGMHKITLDAYGYRWFRAG
DLKHLFHKE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgataggagacttatggtataagaatgcagtcatctacagcctggaccttgaaactttc
atggacctgaacgcagatggcattggcgatttcgaaggcctgacaaggcgcctcgattac
ctgcacgcaatgggtgttgataccgtgtggctggcgccatttcagcctacacctaaccgg
gataatggttacgatgttaaagattactacggagtagatccccggcatggctccagcgga
aattttgtggaatttatgcaccaggctaaaaagcgaggtatcaaagtaatcatagacctg
gtggtgaaccacacttcagatgagcatcactggtttcaggattcacggagcagtgaagat
gcaaaacaccgcgactggtatgtatggtctaaaaagaaacccgacgactgggatgagggc
atggtatttcccggggttcaggacagaacctggacttacgacaaaaaagccaaagcctat
tatcatcaccgcttttatcaatttcagccagacctgaacatagacaatcccgaggtgcga
gaagaaattacccgcatcataggattctggcttgaactgggtgtggcaggctttcgggta
gatgcagttccatttttactggaaacacagaatccgggagaaaccagcaaagaaatcagg
tttgaatacctgcgcgaaattcgcagatttttacaatggcggaaaggcaatgctattttg
ctgggggaggcaaacgtatcgccggaagaaaccaaagattactttggttttgaaggaaac
ggcatccatatgatgttcaacttctatgtaaaccagtacctgttttatgcgcttgctaca
gccgaaaccaagcccctgatcaaagcactggaggaaacccgcaataccttacccgccaac
caatgggctcattttttgcgtaaccacgatgaacttgacctgggcaggcttagcgaagag
gaacgtaaaaaggtgtttgcccgctttgctcctgaaaaacatatgcagttgtatgacagg
ggcatccgccggcgcgtagctaccatgctggggaacaggcaacagactgaactggcatac
agccttatattttctttaccgggagctcctgttattcgctatggcgatgagataaacatg
ggcgataacctggagctggaagagagaaatgcagtacgtacccctatgcagtggtcggat
ggtccgcaggcaggtttttccaaagcagaaaaactggttcaccctgtaattgatagcggg
ccttatgcttatcagcatgtaaacgtagaaaatcagcgccgtactcctgattcaatgctc
aactggatgaccaccctgatccgtttacggcaggagtgtaccgaaataggttggggggac
tggcagattatggaaaccggcgttgaacaggtgctctgcatgcattataactggaagggc
agctcactggtgatattgcacaacttcgatgaaaaagcccatgaagtaagcctgaagctg
gagcgcgatgaagaaacaaagcttgtagacctgatggttgactacgtaagtgttgccgaa
ggcaaaggaatgcataaaataacactggatgcatatggataccgctggttccgggcaggt
gatcttaaacatttatttcacaaagagtaa

DBGET integrated database retrieval system