KEGG   Flavobacteriaceae bacterium UJ101: UJ101_00428Help
Entry
UJ101_00428       CDS       T04720                                 

Gene name
OGDH|sucA
Definition
(GenBank) oxoglutarate dehydrogenase (succinyl-transferring)
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fbu  Flavobacteriaceae bacterium UJ101
Pathway
fbu00020  Citrate cycle (TCA cycle)
fbu00310  Lysine degradation
fbu00380  Tryptophan metabolism
fbu01100  Metabolic pathways
fbu01110  Biosynthesis of secondary metabolites
fbu01120  Microbial metabolism in diverse environments
fbu01130  Biosynthesis of antibiotics
fbu01200  Carbon metabolism
Module
fbu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fbu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fbu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    UJ101_00428 (OGDH|sucA)
  Amino acid metabolism
   00310 Lysine degradation
    UJ101_00428 (OGDH|sucA)
   00380 Tryptophan metabolism
    UJ101_00428 (OGDH|sucA)
Enzymes [BR:fbu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     UJ101_00428 (OGDH|sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: APD05975
UniProt: A0A1J0LK16
LinkDB All DBs
Position
complement(478460..481234)
Genome map
AA seq 924 aa AA seqDB search
MDRYSFLNAVHPEVLETQYEKYLQSPDSVEPSWRAFFQGFDFGRDESYGEELFEAQTAVA
SNSNVSTSQPVSTNTQVNKEFKVINLINDYRKRGHLFTKTNPVRERRDYNPKITLQNHGL
SEADLNDTFKAGEIIGLPNATLKEIIAQLKSIYCESIGVEYMYIRDPEKVEWIQSWINRN
SNKPNFSVDQKKHILHKLNQAVSFENYLHTKFVGQKRFSLEGGETLIPALDSLIEHATNQ
HHVEEFVVGMAHRGRLNVLTNIFGKTYEQIFSEFQGKELEESVFSGDVKYHLGSTTFAKS
SHSDKQVKINLAPNPSHLETVDAVVEGIARAKVDLDYDGDYNKLVPVLIHGDAAVAGQGI
VYEVIQMMKLRGYKTGGTIHIVINNQIGFTTNYLDARSSTYCTDVGKVTLSPVLHVNADD
AEAVVHALQFAIDYRMRFGRDVFIDLLGYRKYGHNEGDEPRFTQPKLYKAISKHPNPRQI
YNDKLKQEGIIGDDVLKEMEKQFKELLDKDFDASKAREKNQLEPFMEDEWEGYELMLEEK
GMFEPVDTTVSKETLTEIAKVLGELPSDKKFIRKIEKIINGRKKAFEEGTNLDWGLAEML
AYGTLMKEGHNVRISGEDVQRGTFSHRHAVVKTEEAEEITLINQLNTGAKFEAYNSHLSE
YGVVGFDYGYALAAPNTMTIWEAQFGDFSNGAQIMFDQYMSAAEDKWKMQNGLVLLLPHG
YEGQGAEHSSARIERYLQLCASSNMTVANCTTPGNHFHLLRRQMKRNFRKPLVVFTPKSL
LRHPRCVSTIDDLANGSFQEVIDDQTAKAAKVKKVVLVSGKFYYDLLAKKEEKKAEHIAL
VRVEQLYPLAKTEINKIISKYTNAIEIIWAQEEPENMGAWSYILRQLREIPFQVACPPES
AATAAGSATRHAKFHNAVIDKIID
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggatagatattcctttttgaatgcggtacacccagaagttctggaaacgcaatacgaa
aagtatttacagagtccagatagtgtagaaccaagttggagagccttttttcaaggattc
gattttggaagagatgaatcatatggagaagaattatttgaagcccaaactgcggttgct
tctaattcaaatgtatctacttcacaaccagtttctactaatactcaagtaaataaagag
tttaaagttattaatttaattaatgattatcgtaaaagaggtcatttgtttacgaaaacg
aatccagttagagaacgtagagattataatccaaaaattacattacaaaatcatggctta
tctgaagctgatttaaatgatacgttcaaagcaggtgaaattattggattacccaatgct
actttaaaagagattatcgcacaattaaaaagtatttattgtgaatcaataggagtagaa
tatatgtatatccgagatcctgaaaaagtagaatggattcaatcttggattaaccgtaat
tcgaataaaccgaatttttctgtagatcaaaagaaacacatattacataagttaaatcaa
gccgtatcatttgaaaattatttgcataccaaatttgtagggcaaaaacgattttcatta
gaaggaggtgaaaccttgatccctgctttagattctttaatagagcatgcaaccaatcaa
catcatgttgaagaatttgtagtgggaatggcacaccgtggtcgtttgaatgttttaact
aatatctttggaaaaacgtatgaacaaatatttagtgaatttcaagggaaagaattagaa
gaatctgttttctcaggagatgtgaaatatcatctaggatcgacaacatttgctaaaagt
tcacacagtgataagcaagtaaaaattaacttggcgcctaatccatctcacttagaaaca
gtagatgctgttgtagaaggaattgcacgtgctaaagttgatttagattatgatggagat
tataataaattagttcctgtattaattcacggtgatgctgctgtagcaggtcaaggaatt
gtttatgaagtgattcaaatgatgaaacttcgtggttataaaacaggagggactattcat
attgtaattaataatcaaattggatttacaactaattatttagatgctcgttctagtact
tattgtactgatgttggaaaagtaaccctttctccagtattacacgttaatgcagatgat
gcggaagcagtagtgcatgcattacaatttgcaattgattatcgtatgcgttttggaaga
gatgtatttattgatttattaggataccgtaaatacggtcataatgaaggagatgaacct
cgttttacacagcctaagttatacaaagcaatttcaaaacatcctaatcctagacaaatt
tataatgataaattaaagcaagaaggaattataggagatgatgtgctaaaagaaatggaa
aaacaattcaaagaattgttagacaaagattttgatgcatcaaaagcaagagaaaaaaat
caattagaacctttcatggaagatgaatgggaaggttatgaattgatgttagaagaaaag
ggaatgtttgaaccagttgatacaacagtatcaaaagaaacgttgactgaaatagcaaaa
gttttaggagaacttccttctgataagaaattcattcgaaaaattgaaaaaatcattaat
ggacgtaaaaaagcgtttgaagaaggaactaatttagattggggacttgctgaaatgctt
gcttatggaacattgatgaaagaaggacataatgttcgtatttcaggagaagatgttcaa
agaggtacgttctcgcatcgtcatgctgtagtaaaaacagaagaggcagaagaaatcact
ttaatcaatcaattaaatacgggtgctaagtttgaagcatataattcacatttatcagaa
tatggtgtggttggatttgattatgggtatgcgttagcagcacctaatacgatgactatt
tgggaagcacaatttggagacttcagtaatggagctcaaattatgtttgatcaatacatg
tcagctgctgaagataaatggaaaatgcaaaatggtttagtacttttattaccgcacggt
tatgaagggcaaggggcagagcattcatcagcacgtattgagcgctatttacaattatgt
gcatcatctaatatgaccgttgcgaattgtacaacaccagggaaccattttcacttatta
cgtcgtcagatgaaacgtaattttagaaaaccattagttgtttttacacctaaaagttta
ttacgtcatcctcgttgtgtttctacaattgatgatttggctaatggaagttttcaagaa
gtgattgatgatcaaactgctaaggcagcaaaagtgaaaaaagttgtattggtttcagga
aagttctattatgacctattagcaaaaaaagaagaaaagaaagcagaacatattgcatta
gttcgtgttgaacaattatatcccttagctaagactgaaattaataaaattatttcaaaa
tataccaatgctattgagatcatttgggcacaagaagagcctgaaaatatgggagcttgg
tcttatattttacgtcaattacgtgaaataccgttccaggtagcttgtccaccagaaagt
gctgcaacagcagcaggttctgctactcgacatgctaaattccataatgcagtaattgat
aaaataattgattag

DBGET integrated database retrieval system