KEGG   Felis catus (domestic cat): 100126581Help
Entry
100126581         CDS       T02385                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2 precursor
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00590  Arachidonic acid metabolism
fca01100  Metabolic pathways
fca04064  NF-kappa B signaling pathway
fca04370  VEGF signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca04723  Retrograde endocannabinoid signaling
fca04726  Serotonergic synapse
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca04923  Regulation of lipolysis in adipocytes
fca05140  Leishmaniasis
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05204  Chemical carcinogenesis
fca05206  MicroRNAs in cancer
fca05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100126581 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    100126581 (PTGS2)
   04064 NF-kappa B signaling pathway
    100126581 (PTGS2)
   04668 TNF signaling pathway
    100126581 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100126581 (PTGS2)
   04657 IL-17 signaling pathway
    100126581 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100126581 (PTGS2)
   04913 Ovarian Steroidogenesis
    100126581 (PTGS2)
   04921 Oxytocin signaling pathway
    100126581 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    100126581 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    100126581 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    100126581 (PTGS2)
   05206 MicroRNAs in cancer
    100126581 (PTGS2)
   05204 Chemical carcinogenesis
    100126581 (PTGS2)
   05222 Small cell lung cancer
    100126581 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    100126581 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100126581 (PTGS2)
   05165 Human papillomavirus infection
    100126581 (PTGS2)
   05140 Leishmaniasis
    100126581 (PTGS2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100126581 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 100126581
NCBI-ProteinID: NP_001103919
Ensembl: ENSFCAG00000023081
UniProt: A8QIU4
LinkDB All DBs
Position
F1
AA seq 604 aa AA seqDB search
MLARALLLCAALALCRAANPCCSNPCQNQGVCLSIGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYKLTHFKGVWNIVNNIPFLQNIIMKYVLTSRSHLIESPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLSHVYGETLDRQHKLRLFKDGKMKY
QIIDGEVYPPTVKDTQVEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLIMIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTLQIDDQEYNFQQFVYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAVQQVAKASIDQSRQMKYQSLNEYRKRFRLKPYTSFEELTGEKEMAAGLEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEMGAPFSLKGLMGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcccgcgccctgctgctctgcgccgccctggcgctctgccgtgcagcaaatcct
tgctgttccaacccatgccaaaaccaaggtgtatgcctgagcataggatttgaccagtat
aagtgtgactgtacccgaacaggattctatggtgaaaactgttcaacacctgaatttctg
acaagaataaagttattcctgaaacccactccaaatacagtgcactacaaacttacccac
ttcaagggagtctggaacattgtcaataacattcccttcctgcaaaatataattatgaaa
tatgtgttgacatccaggtcacatttgatcgagagcccaccaacttacaatgtggactat
ggctataaaagctgggaagccttttccaatctctcctattataccagagctcttccccct
gtggctgatgactgcccaacacccatgggtgtgaaaggcaagaaagagcttcctgattca
aaagagattgtggaaaaatttcttctaagaagaaagttcattcctgacccccaaggcaca
aatatgatgtttgcattttttgcccaacacttcacccatcaatttttcaagacagatcat
aagcgaggaccagctttcaccaaaggactgggccatggggtggacttaagtcatgtttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatac
cagataatcgatggggaggtgtatcctcccacagtcaaagatactcaggtcgagatgatc
tacccacctcatgttcctgaacacctgcggtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtacgccacaatttggctgcgggaacacaacagagtgtgtgat
gtgcttaaacaggagcatccagaatgggatgatgagcggttgttccagacgagcaggcta
ataatgataggagaaaccattaagattgtgattgaagactatgtacaacacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccaataccaa
aaccgtattgctgctgagtttaacacactctaccactggcatccccttctgcctgacacc
ttgcaaatagatgaccaggagtacaatttccagcagtttgtctacaacaactctatatta
ctggaacatgggcttacccagttcgtggaatcattcagcaggcaaattgctggcagggtt
gctggtggtaggaatgttccagctgcagtgcagcaagtagcaaaggcctcaatcgaccag
agcagacagatgaagtaccagtctcttaatgagtatcgcaaacgctttcggctgaagccc
tatacatcgtttgaagaactcacaggagagaaggaaatggctgcggggttagaagcactt
tatggtgatattgatgccatggagctgtatcctgcccttctggtagaaaagcctcgccct
gatgccatctttggtgagaccatggtagaaatgggagcaccattctccttgaaaggactt
atgggtaatcctatatgttctcctgactactggaagcctagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcgattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgcattcagtgttcaagatccacagctcaccaaaacagtcaccattaat
gcaagctcttcgcactctggactggatgatatcaatcccacagtactgctaaaagaacgt
tcaactgaactgtag

DBGET integrated database retrieval system